spacer

EBI Dbfetch

ID   AK148140; SV 1; linear; mRNA; HTC; MUS; 1577 BP.
XX
AC   AK148140;
XX
DT   06-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 11)
XX
DE   Mus musculus B16 F10Y cells cDNA, RIKEN full-length enriched library,
DE   clone:G370032C06 product:Adiponectin receptor protein 1, full insert
DE   sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1577
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (30-MAR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; c023c380d21ceea0d265fb4d2588ecdf.
DR   Ensembl-Gn; ENSMUSG00000026457; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000027727; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000112237; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Cells were provided by Drs. William J Pavan and Stacie Loftus and
CC   Denise Larson (Division of Intramural Research Genetic Disease
CC   Research Branch National Human Genome Reseach Institute National
CC   Institutes of Health (NIH) Building:  49, Room 4A82 49 Convent
CC   Drive MSC 4472 Bethesda,Maryland U.S.A) whose assistance we
CC   gratefully acknowledge.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=G370032C06
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1577
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="G370032C06"
FT                   /cell_type="B16 F10Y cells"
FT                   /db_xref="taxon:10090"
FT   CDS             199..1326
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="Adiponectin receptor protein 1 (UniProt|Q91VH1,
FT                   evidence: FASTY, 100%ID, 100%length, match=1125)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q53YY4"
FT                   /db_xref="InterPro:IPR004254"
FT                   /db_xref="MGI:MGI:1919924"
FT                   /db_xref="UniProtKB/TrEMBL:Q53YY4"
FT                   /protein_id="BAE28369.1"
FT                   /translation="MSSHKGSAGAQGNGAPSGNREADTVELAELGPLLEEKGKRAASSP
FT                   AKAEEDQACPVPQEEEEEVRVLTLPLQAHHAMEKMEEFVYKVWEGRWRVIPYDVLPDWL
FT                   KDNDYLLHGHRPPMPSFRACFKSIFRIHTETGNIWTHLLGFVLFLFLGILTMLRPNMYF
FT                   MAPLQEKVVFGMFFLGAVLCLSFSWLFHTVYCHSEKVSRTFSKLDYSGIALLIMGSFVP
FT                   WLYYSFYCSPQPRLIYLSIVCVLGISAIIVAQWDRFATPKHRQTRAGVFLGLGLSGVVP
FT                   TMHFTIAEGFVKATTVGQMGWFFLMAVMYITGAGLYAARIPERFFPGKFDIWFQSHQIF
FT                   HVLVVAAAFVHFYGVSNLQEFRYGLEGGCTDDSLL"
XX
SQ   Sequence 1577 BP; 308 A; 450 C; 442 G; 377 T; 0 other;
     ggagggcgct gaggatcggg cgcccctcgg ccgcaggccg cctccagtgc cgcgggatgt        60
     agcgcccggg cccgcggccc ccagcagagg cagccagcca ggcctgtcca ccatcacagg       120
     aagatctctg ccctctgggg ctgagagacc ccaacctttc ttcaagctga agctgccagg       180
     cactgaggta ccagccagat gtcttcccac aaaggctctg ccggggcaca aggcaatggg       240
     gctccttctg gtaacagaga agctgacaca gtggagctgg ctgagctggg gcccctgctg       300
     gaggagaagg gcaagcgggc agccagcagc ccagccaagg ctgaggaaga tcaagcatgc       360
     ccggtgcctc aggaagagga ggaggaggtg cgggtgctga cgcttcctct gcaagcccac       420
     catgccatgg agaagatgga ggagttcgtg tataaggtct gggagggacg ttggagagtc       480
     atcccgtatg atgtgcttcc tgactggctg aaagacaacg actacctgct acatggccac       540
     agaccaccta tgccctcctt tcgggcttgc ttcaagagca tcttccgcat ccacacagag       600
     actggcaaca tctggacaca tctgcttggt tttgtgctat ttctctttct gggaatcttg       660
     acgatgctga gaccaaatat gtacttcatg gctcccctgc aggagaaggt ggtcttcggg       720
     atgttcttcc tgggcgcggt gctctgcctc agtttctcct ggctcttcca cactgtctac       780
     tgtcattcag agaaggtctc tcggactttt tccaaactgg actattcagg gattgctcta       840
     ctgattatgg ggagcttcgt tccctggctc tattactcct tctactgctc cccacagccg       900
     cggctcatct acctctccat cgtctgtgtc ctgggcatct ctgccatcat tgtggcacag       960
     tgggaccggt ttgccactcc caagcaccgg cagacaagag caggagtgtt cctgggactt      1020
     ggcttgagtg gtgttgtacc caccatgcac tttactatcg ctgagggctt tgtcaaggcc      1080
     accacggtgg gccagatggg ctggttcttc ctcatggctg tgatgtacat caccggcgcc      1140
     ggcctgtatg ctgctcggat tcctgagcgc ttcttccctg gaaaatttga catctggttc      1200
     cagtctcatc agattttcca cgtcctggtg gtggcagcag ctttcgtcca cttctatggt      1260
     gtgtccaacc ttcaggaatt ccgttatggc ctagaaggtg gctgtaccga cgactccctt      1320
     ctctgagcct ccccacctga ggggtggagg aggggcttcc caagtgcttt taaaaataac      1380
     ttctttgctg aagtatgagg aagagtctga gttgtctgtt tctagaagaa atctcttaga      1440
     gaagtcagta ccagtgacat gtcagctcac tgtcccagcc tccgtccggg cagtacactt      1500
     cccatgtgca ttcccggcag tcacctcggc aaggcaactg ctgctccttc acagatagga      1560
     cgtgggagct catgttg                                                     1577
//


spacer
spacer