
ID   AK148026; SV 1; linear; mRNA; HTC; MUS; 3016 BP.
AC   AK148026;
DT   06-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 10)
DE   Mus musculus melanocyte cDNA, RIKEN full-length enriched library,
DE   clone:G270143I24 product:guanine nucleotide binding protein (G protein),
DE   gamma 7 subunit, full insert sequence.
KW   CAP trapper; HTC; HTC_FLI.
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
RN   [1]
RP   1-3016
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (30-MAR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
DR   MD5; 18628633f27fc9c1a32843d43e325605.
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Cells were provided by Drs. William J Pavan and Stacie Loftus and
CC   Denise Larson (Division of Intramural Research Genetic Disease
CC   Research Branch National Human Genome Reseach Institute National
CC   Institutes of Health (NIH) Building:  49, Room 4A82 49 Convent
CC   Drive MSC 4472 Bethesda,Maryland U.S.A) whose assistance we
CC   gratefully acknowledge.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=G270143I24
FH   Key             Location/Qualifiers
FT   source          1..3016
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="G270143I24"
FT                   /cell_type="melanocyte"
FT                   /db_xref="taxon:10090"
FT   CDS             <5..100
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="guanine nucleotide binding protein (G protein),
FT                   gamma 7 subunit (MGD|MGI:95787 GB|NM_010319, evidence:
FT                   BLASTN, 99%, match=3013)"
FT                   /note="putative"
FT                   /note="start codon is not identified"
FT                   /db_xref="GOA:Q3UGB3"
FT                   /db_xref="InterPro:IPR001770"
FT                   /db_xref="InterPro:IPR015898"
FT                   /db_xref="MGI:MGI:95787"
FT                   /db_xref="UniProtKB/TrEMBL:Q3UGB3"
FT                   /protein_id="BAE28296.1"
FT                   /translation="YCEQHARNDPLLVGVPASENPFKDKKPCIIL"
FT   regulatory      2987..2992
FT                   /note="putative"
FT                   /regulatory_class="polyA_signal_sequence"
FT   polyA_site      3016
FT                   /note="putative"
SQ   Sequence 3016 BP; 687 A; 874 C; 753 G; 702 T; 0 other;
     gcgctactgt gagcaacatg cccgcaacga tcccttgctg gttggcgtgc cagcctctga        60
     gaatccattc aaagacaaaa agccttgcat aattctctag ttctctctct ttctctctct       120
     cttccccatc tctccctctc tttctcccca ccccggaggt attggtccaa tttttcctgt       180
     aaggaaaata tttgaatcct tcccactttg aattctaaag gaacaaaaac cattgtgaat       240
     gccgggatct tcctgaccta gctggagttt atgaacccag gtggggctct gactgtcgcc       300
     tggcctaact gagatgttag cctcgtcacc cccaccccct cttttcaaga gtcactactg       360
     tggcccattt ttaaagctcc ccttagttgc cttggggaaa gggctccgtt gataaacggg       420
     attgccttgc aagcgtgagg accctaggtg cggcgcggtc ctcaggtccc acagaaagca       480
     tgcaggtgca gtgtcacaag gttgtatgta cttcagcact tggtaggcaa ggcagaaggg       540
     tccccagggc ttgagggact gccattctag ttgtcagtaa actccagaca gaggaggaca       600
     cccagccttg acctctggct ccacccgcgc ggggcacaca caatgcaccc tgtgctgccc       660
     tgtgtccttc cagagtggcc ctgtcatgta cacagtgacg ccatttctcc agagacatgg       720
     cccattccag agacgggcat ctgggtctcc attcaaagga agctcttgct ggtatgaccg       780
     agtgtgtaat tttgtctcct aagcctgaga tccacgtggt cattggtggc tccccatttt       840
     ctcccagtta cacagttatc caggtagttg tgagggcaga aatgcagatt agttatctct       900
     cgaggtgatc gaggagtgac ggggttctcc gtcccacatc gtgactgtgg ctccagatcc       960
     ccctgcctcc ttcctaggac aaactatttt gtaactagct agaatccaag cccctcagtg      1020
     tggggactgt agccctggtc tgcactccca gattggggga ttctaggcag ggctccaccc      1080
     agaccacacc ccaatgagga tttggggact ctaggcgggg ctccaccccg aactgcgacc      1140
     tcagcccctt actggggcat tctaggtggg gctctacatt gaccactccc ccagcccctc      1200
     actgggagat tgtagtctgg ggctccaccc tgaccacgcc cctagaccct tgttggtaga      1260
     ttctccacag cattctaccc ctgagccagg cctcttctct ttctattttg tgaacagagc      1320
     cctagagtcc aggctggcct ggaacaggag atcttcctgc ctctgtctcc agagtaccta      1380
     catgacggtc ttgtgcttgc atgcctggca ttggattgga ctgaagaaaa catgccctct      1440
     gtctgtaaca gtgacagtgg caggtatagg gaggacacga cttgggtgtg ccaatgcggt      1500
     gtgcagccac acacagaggc agcctaagca tttgaaagac cccagctgcc tctttctcct      1560
     gccagatcag tatgggagca aaccgcagaa ctgaagccag tctagttgtt ccctgtatcc      1620
     ctggtggaaa tctgctgcca aaagcctggg ccaggctgat ccctgggcaa agtgaaaggg      1680
     gtgagcacag ttagctcatc ttctagccag ttaggcatga cctaccgcct aggtaaggtg      1740
     gcaggctccc ccaaatccat ttgatggaaa caggaaaaga agtctggggt gtgactaagg      1800
     ggaggcattg caggtgctaa gagcgccccc ctcccacttc cccctccgtg ggctgggtcc      1860
     cagagagcac agaccaaggg tctggcttct gtgcatcagc tcccattact ggtcagagag      1920
     ggccagcaac tttggtcagc ctgactctca gaaacctggg cttgagtcag aaaaagccag      1980
     tttcccccac cctcaaacta cagccacctt gcattaggct aggaaccagg tcccaggatg      2040
     tgtgtcccca gctacactgg caaggagaaa ggaaagctgg aaatctgggg accagggctg      2100
     gcagagcacc cacccagcat gctggaaagc tgggttccac ccaaagctcg aagtaaccag      2160
     gcacgggcac tggggtaggc agatcaggac ttcagggtct tcctcagcta cataatgggc      2220
     tcaaggctaa cctggactac atgagaccat gtctcaaatt cagtgcactc tctcactctc      2280
     tcacatcacg acagcagatg cctgcctggc cagcctgtgt gtggtcggag cattttgttt      2340
     ctctcctctg ggacaaaaaa ctcaaatctg catctctgcc cacacttcca gttctccctc      2400
     cctaggtgac tcacaggcca aggacaaagt gacttcttgt tcccaaggaa ggtaggacgt      2460
     gcttggctga tgtattcagg atggaccttg ggccccaata gcccttgtgt gccctcctaa      2520
     ccactggagc cctgcctcag cttagagata cttagggaaa ccagaacaca acagagccat      2580
     caggagccaa gattgggggc cctcaccttc aatcccaaca cttgggagac agaggcaagg      2640
     ggatctccgt gaattcgagg ccagcctcat ctacagagtg agttccagga cagccagggt      2700
     tgtagagaca ccgtctaaaa acaaaataaa acaaccaaaa ctgttagacc tgctgcagct      2760
     tgagccaccc aggagggact tccaacctaa ggagaaggtt ggtgggcatg ggggggtgta      2820
     tcctacacag aagccatata cactggccag atgtcacatg gcactttcca tttccgtcgc      2880
     cacttcaggg ctggctcctc cccctcacgc tccagggctg gctcctaccc cttcagactc      2940
     ctcccccttc cctctgcttt gtgaagctgg ttgtttttta tttctgatta aaaaaaaaac      3000
     tttttcccgt gtgcct                                                      3016