Dbfetch

ID   AK147843; SV 1; linear; mRNA; HTC; MUS; 3231 BP.
XX
AC   AK147843;
XX
DT   06-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 10)
XX
DE   Mus musculus melanocyte cDNA, RIKEN full-length enriched library,
DE   clone:G270063O19 product:guanine nucleotide binding protein (G protein),
DE   gamma 7 subunit, full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-3231
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (30-MAR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; f25e4becf1d0877daf207390f58ba97a.
DR   Ensembl-Gn; ENSMUSG00000048240; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017530; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0017508; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0017469; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017470; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017293; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0017924; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0016860; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0017265; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0017371; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0017365; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0017442; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017391; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0017965; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0016641; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0016920; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000117805; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000118233; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000118465; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0026361; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0026333; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0026301; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0026307; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0026110; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0026802; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0025681; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0026038; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0026163; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0026158; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0026273; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0026155; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0026841; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0025389; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0025639; mus_musculus_wsbeij.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Cells were provided by Drs. William J Pavan and Stacie Loftus and
CC   Denise Larson (Division of Intramural Research Genetic Disease
CC   Research Branch National Human Genome Reseach Institute National
CC   Institutes of Health (NIH) Building:  49, Room 4A82 49 Convent
CC   Drive MSC 4472 Bethesda,Maryland U.S.A) whose assistance we
CC   gratefully acknowledge.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=G270063O19
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3231
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="G270063O19"
FT                   /cell_type="melanocyte"
FT                   /db_xref="taxon:10090"
FT   CDS             122..328
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="guanine nucleotide binding protein (G protein),
FT                   gamma 7 subunit (MGD|MGI:95787 GB|NM_010319, evidence:
FT                   BLASTN, 99%, match=3195)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q3UGN1"
FT                   /db_xref="InterPro:IPR001770"
FT                   /db_xref="InterPro:IPR015898"
FT                   /db_xref="MGI:MGI:95787"
FT                   /db_xref="UniProtKB/TrEMBL:Q3UGN1"
FT                   /protein_id="BAE28176.1"
FT                   /translation="MSGTNNVAQARKLVEQLRIEAGIERIKVSKASSDLMGYCEQHARN
FT                   DPLLVGVPASENPFKDKKPCIIL"
FT   regulatory      3210..3215
FT                   /note="putative"
FT                   /regulatory_class="polyA_signal_sequence"
FT   polyA_site      3231
FT                   /note="putative"
XX
SQ   Sequence 3231 BP; 731 A; 933 C; 825 G; 742 T; 0 other;
     gtgtgcggct gctgagacac tggctggagg cagggtgtga agcctttcta ttggaacctc        60
     agtgctggga cggtgggacg gtgcagctct ctagacgcca ggtccacgct catggccgat       120
     gatgtcaggt actaacaacg tcgcccaggc ccggaagctg gtggagcagc tgcgcattga       180
     agctgggatc gaacgcatca aggtctccaa ggcctcgtca gacctgatgg gctactgtga       240
     gcaacatgcc cgcaacgatc ccttgctggt tggcgtgcca gcctctgaga atccattcaa       300
     agacaaaaag ccttgcataa ttctctagtt ctctctcttt ctctctctct tccccatctc       360
     tccctctctt tctccccacc ccggaggtat tggtccaatt tttcctgtaa ggaaaatatt       420
     tgaatccttc ccactttgaa ttctaaagga acaaaaacca ttgtgaatgc cgggatcttc       480
     ctgacctagc tggagtttat gaacccaggt ggggctctga ctgtcgcctg gcctaactga       540
     gatgttagcc tcgtcacccc caccccctct tttcaagagt cactactgtg gcccattttt       600
     aaagctcccc ttagttgcct tggggaaagg gctccgttga taaacgggat tgcattgcaa       660
     gcgtgaggac cctaggtgcg gcgcggctcc tcaggtccca cagaaagcat gcaggtgcag       720
     tgtcacaagg ttgtatgtac ttcagcactt ggtaggcaag gcagaagggt ccccagggct       780
     tgagggactg ccattctagt tgtcagtaaa ctccagacag aggaggacac ccagccttga       840
     cctctggctc cacccgcgcg gggcacacac aatgcaccct gtgctgccct gtgtccttcc       900
     agagtggccc tgtcatgtac acagtgacgc catttctcca gagacatggc ccattccaga       960
     gacgggcatc tgggtctcca ttcaaaggaa gctcttgctg gtatgaccga gtgtgtaatt      1020
     ttgtctccta agcctgagat ccacgtggtc attggtggct ccccattttc tcccagttac      1080
     acagttatcc aggtagttgt gagggcagaa atgcagatta gttatctctc gaggtgatcg      1140
     aggagtgacg gggttctccg tcccacatcg tgactgtggc tccagatccc cctgcctcct      1200
     tcctaggaca aactattttg taactagcta gaatccaagc ccctcagtgt ggggactgta      1260
     gccctggtct gcactcccag attgggggat tctaggcagg gctccaccca gaccacaccc      1320
     caatgaggat ttggggactc taggcggggc tccaccccga actgcgacct cagcccctta      1380
     ctggggcatt ctaggtgggg ctctacattg accactcccc cagcccctca ctgggagatt      1440
     gtagtctggg gctccaccct gaccacgccc ctagaccctt gttggtagat tctccacagc      1500
     attctacccc tgagccaggc ctcttctctt tctattttgt gaacagagcc ctagagtcca      1560
     ggctggcctg gaacaggaga tcttcctgcc tctgtctcca gagtacctac atgacggtct      1620
     tgtgcttgca tgcctggcat tggattggac tgaagaaaac atgccctctg tctgtaacag      1680
     tgacagtggc aggtataggg aggacacgac ttgggtgtgc caatgcggtg tgcagccaca      1740
     cacagaggca gcctaagcat ttgaaagacc ccagctgcct ctttctcctg ccagatcagt      1800
     atgggagcaa accgcagaac tgaagccagt ctagttgttc cctgtatccc tggtggaaat      1860
     ctgctgccaa aagcctgggc caggctgatc cctgggcaaa gtgaaagggg tgagcacagt      1920
     tagctcatct tctagccagt taggcatgac ctaccgccta ggtaaggtgg caggctcccc      1980
     caaatccatt tgatggaaac aggaaaagaa gtctggggtg tgactaaggg gaggcattgc      2040
     aggtgctaag agcgcccccc tcccacttcc ccctccatgg gctgggtccc agagagcaca      2100
     gaccaagggt ctggcttctg tgcatcagct cccattactg gtcagagagg gccagcaact      2160
     ttggtcagcc tgactctcag aacctggctt gagtcagaaa agccagtttc ccccaccctc      2220
     aaactacagc caccttgcat taggctagga accaggtccc aggatgtgtg tccccagcta      2280
     cactggcaag gagaaaggaa agctggaaat ctggggacca gggctgcaga gcacccaccc      2340
     agcatgctgg aaagctgggt tccaccccaa gctcgaagta accaggcacg ggcactgggg      2400
     taggcagatc aggacttcag ggtcttcctc agctacataa tgggctcaag gctaacctgg      2460
     actacatgag accatgtctc aaattcagtg cactctctca ctctctcaca tcacgacagc      2520
     agatgcctgc ctggccagcc tgtgtgtggt cggagcattt tgtttctctc ctctgggaca      2580
     aaaaactcaa atctgcatct ctgcccacac ttccagttct ccctccatag gtgactcaca      2640
     ggccaaggac aaagtgactt cttgttccca aggaaggtag gacgtgcttg gctgatgtat      2700
     ccaggatgga ccttgggccc caatagccct tgtgtgccct cctaaccact ggagccctgc      2760
     ctcagcttag agatacttag ggaaaccaga acacaacaga gccatcagga gccaagattg      2820
     ggggccctca ccttcaatcc caacacttgg gagacagagg caaggggatc tccgtgaatt      2880
     cgaggccagc ctcatctaca gagtgagttc caggacagcc agggttgtag agacaccgtc      2940
     taaaaacaaa ataaaacaac cgaaactgtt agacctgctg cagcttgagc cacccaggag      3000
     ggacttccaa cctaaggaga aggttggtgg gcatgggggg gtgtatccta cacagaagcc      3060
     atatacactg gccatgtcac atggcacttt ccatttccgt ccccacttca gggctggctc      3120
     ctccccctca cgctccaggg ctggctccta ccccttcaga ctcctccccc ttccctctgc      3180
     tttgtgaagc tggttggttt ttatttctga ttaaaaaaaa aactttttcc c               3231
//