spacer

EBI Dbfetch

ID   AK147303; SV 1; linear; mRNA; HTC; MUS; 6939 BP.
XX
AC   AK147303;
XX
DT   06-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 11)
XX
DE   Mus musculus adult male brain UNDEFINED_CELL_LINE cDNA, RIKEN full-length
DE   enriched library, clone:M5C1011G02 product:sortilin-related receptor, LDLR
DE   class A repeats-containing, full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-6939
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (30-MAR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 222a23a6a602399ec0cd314f3c478fcd.
DR   Ensembl-Gn; ENSMUSG00000049313; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000060989; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=M5C1011G02
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..6939
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6"
FT                   /mol_type="mRNA"
FT                   /sex="male"
FT                   /dev_stage="adult"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="M5C1011G02"
FT                   /cell_line="UNDEFINED_CELL_LINE"
FT                   /tissue_type="brain"
FT                   /db_xref="taxon:10090"
FT   CDS             178..6825
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="putative"
FT                   /note="sortilin-related receptor, LDLR class A
FT                   repeats-containing (MGD|MGI:1202296 GB|AB015790, evidence:
FT                   BLASTN, 99%, match=6648)"
FT                   /db_xref="GOA:O88307"
FT                   /db_xref="InterPro:IPR000033"
FT                   /db_xref="InterPro:IPR002172"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR006581"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR023415"
FT                   /db_xref="MGI:MGI:1202296"
FT                   /db_xref="UniProtKB/Swiss-Prot:O88307"
FT                   /protein_id="BAE27834.1"
FT                   /translation="MATRSSRRESRLPFLFALVALLPRGALGGGWTQRLHGGPAPLPQD
FT                   RGFFVVQGDPRDLRLGTHGDAPGASPAARKPLRTRRSAALQPQPIQVYGQVSLNDSHNQ
FT                   MVVHWAGEKSNVIVALARDSLALARPKSSDVYVSYDYGKSFSKISEKLNFGVGNNSEAV
FT                   ISQFYHSPADNKRYIFVDAYAQYLWITFDFCSTIHGFSIPFRAADLLLHSKASNLLLGF
FT                   DRSHPNKQLWKSDDFGQTWIMIQEHVKSFSWGIDPYDQPNAIYIERHEPFGFSTVLRST
FT                   DFFQSRENQEVILEEVRDFQLRDKYMFATKVVHLPGSQQQSSVQLWVSFGRKPMRAAQF
FT                   VTKHPINEYYIADAAEDQVFVCVSHSNNSTNLYISEAEGLKFSLSLENVLYYSPGGAGS
FT                   DTLVRYFANEPFADFHRVEGLQGVYIATLINGSMNEENMRSVITFDKGGTWEFLQAPAF
FT                   TGYGEKINCELSQGCSLHLAQRLSQLLNLQLRRMPILSKESAPGLIIATGSVGKNLASK
FT                   TNVYISSSAGARWREALPGPHYYTWGDHGGIIMAIAQGMETNELKYSTNEGETWKTFVF
FT                   SEKPVFVYGLLTEPGEKSTVFTIFGSNKESVHSWLILQVNATDALGVPCTENDYKLWSP
FT                   SDERGNECLLGHKTVFKRRTPHATCFNGEDFDRPVVVSNCSCTREDYECDFGFKMSEDL
FT                   SLEVCVPDPEFSGKPYSPPVPCPVGSSYRRTRGYRKISGDTCSGGDVEARLEGELVPCP
FT                   LAEENEFILYAMRKSIYRYDLASGATEQLPLSGLRAAVALDFDYERNCLYWSDLALDTI
FT                   QRLCLNGSTGQEVIINSGLETVEALAFEPLSQLLYWVDAGFKKIEVANPDGDFRLTIVN
FT                   SSVLDRPRALVLVPQEGVMFWTDWGDLKPGIYRSYMDGSAAYRLVSEDVKWPNGISVDS
FT                   QWIYWTDAYLDCIERITFSGQQRSVILDSLPHPYAIAVFKNEIYWDDWSQLSIFRASKH
FT                   SRSQVEILASQLTGLMDMKVFYKGKNAGSNACVPQPCSLLCLPKANNSKSCRCPEGVAS
FT                   SVLPSGDLMCDCPQGYQRKNNTCVKEENTCLRNQYRCSNGNCINSIWWCDFDNDCGDMS
FT                   DERNCPTTVCDADTQFRCQESGTCIPLSYKCDLEDDCGDNSDESHCEMHQCRSDEFNCS
FT                   SGMCIRSSWVCDGDNDCRDWSDEANCTAIYHTCEASNFQCHNGHCIPQRWACDGDADCQ
FT                   DGSDEDPVSCEKKCNGFHCPNGTCIPSSKHCDGLRDCPDGSDEQHCEPFCTRFMDFVCK
FT                   NRQQCLFHSMVCDGIVQCRDGSDEDAAFAGCSQDPEFHKECDEFGFQCQNGVCISLIWK
FT                   CDGMDDCGDYSDEANCENPTEAPNCSRYFQFHCENGHCIPNRWKCDRENDCGDWSDEKD
FT                   CGDSHVLPSPTPGPSTCLPNYFHCSSGACVMGTWVCDGYRDCADGSDEEACPSLANSTA
FT                   ASTPTQFGQCDRFEFECHQPKKCIPNWKRCDGHQDCQDGQDEANCPTHSTLTCTSREFK
FT                   CEDGEACIVLSERCDGFLDCSDESDEKACSDELTVYKVQNLQWTADFSGDVTLTWMRPK
FT                   KMPSASCVYNVYYRVVGESIWKTLETHSNKTSTVLKVLKPDTTYQVKVQVHCLNKVHNT
FT                   NDFVTLRTPEGLPDAPRNLQLSLNSEEEGVILGHWAPPVHTHGLIREYIVEYSRSGSKM
FT                   WASQRAASNSTEIKNLLLNALYTVRVAAVTSRGIGNWSDSKSITTIKGKVIQAPNIHID
FT                   SYDENSLSFTLTMDGDIKVNGYVVNLFWSFDAHKQEKKTLSFRGGSALSHRVSNLTAHT
FT                   SYEISAWAKTDLGDSPLAFEHILTRGSSPPAPSLKAKAINQTAVECIWTGPKNVVYGIF
FT                   YATSFLDLYRNPKSVTTSLHNKTVIVSKDEQYLFLVRVLIPYQGPSSDYVVVKMIPDSR
FT                   LPPRHLHAVHIGKTSALIKWESPYDSPDQDLFYAIAVKDLIRKTDRSYKVRSRNSTVEY
FT                   SLSKLEPGGKYHIIVQLGNMSKDSSIKITTVSLSAPDALKIITENDHVLLFWKSLALKE
FT                   KQFNETRGYEIHMSDSAVNLTAYLGNTTDNFFKVSNLKMGHNYTFTVQARCLFGSQICG
FT                   EPAVLLYDELSSGADAAVIQAARSTDVAAVVVPILFLILLSLGVGFAILYTKHRRLQSS
FT                   FSAFANSHYSSRLGSAIFSSGDDLGEDDEDAPMITGFSDDVPMVIA"
XX
SQ   Sequence 6939 BP; 1635 A; 1860 C; 1906 G; 1538 T; 0 other;
     ggggacccgg cggcggcggt ggccgtggct gcggtggcgg gcgcagcgga gcggcccggg        60
     cggcttggag ccccgggagc ggcgcgcgcg gccccggccc tggccccgcg ctgtcccggc       120
     gcgcgctgca cattctctcc tggcggcggc gccacctgcg ggagcgttcg cccgaacatg       180
     gcgacacgga gcagcaggag ggagtcgaga ctccctttcc tattcgccct ggtcgcgctg       240
     ctaccccgcg gggctctcgg cgggggctgg acgcagagat tgcacggtgg cccggcgccc       300
     ttgccccagg accggggctt cttcgtggtg cagggcgacc cgcgcgatct ccggctagga       360
     acgcacgggg atgccccggg ggcgagcccg gcggccagga agccactcag gacccggcgg       420
     agcgctgctc tgcagcccca gcctatccag gtgtatggac aggtcagtct gaatgactcc       480
     cacaatcaga tggtggtgca ctgggccgga gagaaaagca acgtgatcgt ggcattagcc       540
     cgagacagcc tggcgttggc aaggcccaag agcagtgatg tgtatgtgtc ttacgactat       600
     ggaaaatcat tcagtaagat ttcagagaag ctgaactttg gcgtgggcaa caacagcgaa       660
     gctgtgatct cccagttcta ccacagccct gctgacaaca agaggtacat ctttgtggat       720
     gcttacgccc aatacctctg gatcacattt gacttctgca gcactatcca tggcttctcc       780
     atcccattcc gggcggctga tctcctcctc catagcaagg cctccaacct cctcttgggc       840
     tttgacaggt ctcaccccaa caagcagcta tggaagtcag atgattttgg ccagacctgg       900
     atcatgattc aggaacacgt gaagtccttc tcttggggaa tcgaccccta tgatcagcca       960
     aacgctatct acattgagcg acatgaaccc tttgggttct ccacagtgct ccgcagtaca      1020
     gacttcttcc agtcccggga aaaccaggaa gtgatcctgg aggaagtgag agactttcag      1080
     cttcgcgaca agtatatgtt tgctacaaag gtggtgcatc ttccgggcag ccagcagcag      1140
     tcatctgtcc agctctgggt ctcctttggc cggaagccta tgagagcagc ccagtttgtc      1200
     acaaagcatc ctattaatga atattacatc gctgatgccg ccgaggacca ggtgttcgtg      1260
     tgtgttagcc acagtaacaa cagcactaac ttatacatct cagaggcaga ggggctgaag      1320
     ttctccctct ccttggagaa tgtgctgtat tacagcccag gaggggccgg cagtgacact      1380
     ctggtgaggt attttgcaaa tgagccgttt gccgactttc accgcgtgga aggcttacaa      1440
     ggagtctata ttgccaccct gattaatggt tctatgaatg aggagaacat gaggtcggtc      1500
     atcacctttg acaaaggggg aacctgggaa tttcttcagg ccccagcctt cacaggatat      1560
     ggagagaaaa tcaattgtga gctttctcag ggttgttccc tccacctggc ccagcgcctc      1620
     agtcaactgc tcaacctcca acttcggagg atgcctatcc tatccaagga gtcagccccc      1680
     ggtctcatca ttgctaccgg ctctgtggga aagaacttgg ccagcaagac caatgtgtac      1740
     atctctagca gtgctggagc caggtggaga gaggctcttc ccggacctca ttactatact      1800
     tggggtgacc atggaggcat catcatggcg attgcccagg gcatggagac caacgagctg      1860
     aagtacagca ccaatgaagg ggagacctgg aagacgttcg tcttctcgga gaagcctgtg      1920
     tttgtgtatg ggcttctcac agaacctggt gagaagagca ccgtcttcac catcttcggc      1980
     tcgaacaagg agagtgtcca cagctggctc atcctgcagg tcaatgccac tgatgccttg      2040
     ggggttcctt gcacagaaaa cgactacaag ctgtggtccc catctgatga gcgaggaaat      2100
     gagtgtttgc taggacacaa gacagttttc aaaaggagga cccctcatgc cacgtgcttt      2160
     aatggggaag actttgaccg gccagtggtt gtgtccaact gctcctgcac ccgggaggac      2220
     tacgaatgtg actttggctt caagatgagc gaagatctct ccttagaggt ttgtgttcca      2280
     gaccctgagt tttctgggaa gccctacagc cctcctgtgc cttgtcctgt gggttcttca      2340
     tacaggagaa cgagaggcta tcggaagatt tctggggata cgtgcagtgg aggagacgtt      2400
     gaagcgcggc tggaagggga gctggtcccc tgtccccttg cagaagagaa tgagttcatc      2460
     ctatacgcca tgcgcaagtc catctaccgc tacgacttgg cctcgggagc cacagagcag      2520
     cttcctctct cggggctgcg ggcggctgtg gccctggact ttgactatga acgcaactgc      2580
     ttgtattggt ctgacctggc gctggacacc atccagcgtc tctgcttgaa cgggagcaca      2640
     gggcaggagg tgatcatcaa ttccggcctg gagaccgtgg aggctttggc cttcgaaccc      2700
     ctcagccaat tactttactg ggtggatgcc ggctttaaaa agatcgaggt agctaatcca      2760
     gatggtgact tccgactgac aatcgtcaat tcctctgtgc ttgatcgacc cagggcttta      2820
     gtccttgtac cccaagaagg ggtgatgttc tggactgact ggggggacct gaagcctggg      2880
     atttaccgga gctacatgga cggctctgct gcctaccgcc ttgtgtcaga ggacgtgaag      2940
     tggcccaatg gcatctctgt ggacagccag tggatctact ggacggatgc ttacctggac      3000
     tgtatcgagc gcatcacttt cagtggccag cagcgttcag tcatccttga cagcctccca      3060
     cacccctatg ccatcgctgt ctttaagaat gagatctact gggatgactg gtcacagctc      3120
     agcatcttca gagcttcgaa gcacagcaga tcccaggtgg agattctagc aagccagctc      3180
     acgggcctca tggacatgaa ggttttctac aagggaaaga atgctggaag caacgcttgt      3240
     gtccctcagc cctgcagtct actgtgcctc cctaaggcca acaacagcaa aagctgcagg      3300
     tgtccagaag gtgtggccag cagtgtcctc ccctctgggg acctgatgtg tgactgccct      3360
     cagggctatc aaaggaagaa caacacctgt gtcaaagaag agaacacctg tctccgaaac      3420
     cagtatcgct gcagcaacgg caactgtatc aacagcattt ggtggtgtga tttcgacaat      3480
     gactgtggag acatgagtga cgagagaaat tgccccacga cggtctgtga tgcagacact      3540
     cagttccggt gccaggagtc ggggacttgc attccactct cctataagtg tgaccttgaa      3600
     gatgactgtg gagataacag tgatgagagt cactgtgaga tgcaccagtg tcgtagcgac      3660
     gagttcaact gcagctctgg gatgtgcatc cggtcctcct gggtgtgcga tggagacaac      3720
     gactgtaggg actggtctga tgaagccaac tgtactgcca tctatcatac ctgtgaggcc      3780
     tccaacttcc agtgccacaa tggccactgc atcccccagc gatgggcatg tgacggtgat      3840
     gcggattgcc aggatggctc tgacgaagat cccgtcagct gtgagaaaaa gtgcaatgga      3900
     ttccactgcc caaacggcac gtgcatcccg tccagcaagc attgtgatgg gctgagggac      3960
     tgccccgacg gctccgatga gcagcactgt gagcccttct gcacgcgctt catggacttc      4020
     gtgtgtaaga accgtcagca gtgtctgttc cactccatgg tgtgtgacgg gatcgtccag      4080
     tgccgagatg gctctgatga ggatgcggcc ttcgctggat gctcgcaaga ccccgagttc      4140
     cacaaggagt gcgatgagtt cggcttccag tgtcagaacg gagtgtgcat cagcttgatt      4200
     tggaaatgcg atgggatgga tgactgcggg gactactctg acgaggccaa ctgtgaaaac      4260
     cccacggaag ccccaaactg ttcccgttac tttcagttcc actgtgagaa tggccactgc      4320
     atccccaaca ggtggaaatg tgacagagag aacgactgtg gggactggtc tgatgagaag      4380
     gattgtggag attcacatgt tctaccctcc ccgacccccg ggccctccac gtgtctgccc      4440
     aattacttcc actgcagcag cggggcctgt gtgatgggca cctgggtgtg cgacggctac      4500
     agggactgtg cagatggctc tgatgaggag gcctgcccct ctctagcaaa ctccactgcc      4560
     gcctccactc ccacccagtt cgggcagtgc gaccgatttg agttcgagtg tcaccaacca      4620
     aagaaatgta tccccaactg gaagcgctgt gacggccacc aagattgcca agacggccag      4680
     gatgaagcca actgccccac tcacagcacc ttgacctgta cgagcaggga gttcaagtgt      4740
     gaggacggcg aggcatgcat cgtgctctcg gagcgctgtg atggcttcct ggattgctct      4800
     gatgagagcg atgagaaggc ctgcagcgat gagttaactg tatacaaagt gcagaatctc      4860
     cagtggacag ctgatttctc cggagatgtg actttgacct ggatgcggcc aaagaaaatg      4920
     ccatctgctt cttgtgtata caatgtctac tacagggtgg ttggagagag catatggaag      4980
     accctggaaa cccacagcaa taaaacaagc actgtgctca aggtcctgaa gccagacacc      5040
     acgtaccagg ttaaggtcca ggtgcactgc ctcaacaagg tgcacaacac caatgacttt      5100
     gtgaccctca ggactccaga agggttgcca gatgcccctc ggaatctcca gctctccctg      5160
     aacagtgaag aggaaggtgt gattctcggg cactgggctc ctcccgtcca cacccatggc      5220
     ctcatccgtg agtacattgt ggaatacagc aggagtgggt ccaagatgtg ggcctcccag      5280
     agagctgcta gcaactctac agaaataaag aacttactgc tcaatgccct ctacactgtc      5340
     agagtggctg cggtgactag tcgtgggata ggaaactgga gcgattctaa gtccatcacc      5400
     accataaaag gaaaagtgat ccaagcacca aatatccaca ttgacagcta cgatgaaaat      5460
     tctctgagct ttaccctgac catggatggt gacatcaagg tcaatggcta cgtggtgaac      5520
     cttttctggt catttgatgc ccacaaacaa gaaaagaaaa ccctgagctt ccgcggaggg      5580
     agtgcactgt cacacagagt tagcaacctg acagctcata catcctatga gatttctgcc      5640
     tgggccaaga cagacttggg agatagccca ctggcctttg agcacatctt gaccagaggc      5700
     agcagtccac cagctcctag tctcaaagcc aaggccatca atcagactgc agtggagtgc      5760
     atctggactg gccccaagaa tgtggtgtat ggtattttct atgccacatc cttccttgac      5820
     ctctaccgaa accctaagag cgtaactact tcgctccaca ataagacagt catcgtcagc      5880
     aaggatgagc agtatctgtt tctggtccgg gtgttgatcc cttaccaagg gccgtcttct      5940
     gactacgttg tagtgaagat gatcccagac agcaggctcc cgcctcggca tctgcacgcg      6000
     gtccacatag gcaaaacctc agcactcatc aaatgggaat cgccctatga ctctcctgac      6060
     caggacttgt tctacgccat tgcagtgaaa gatctgatca ggaagacgga cagaagctac      6120
     aaagtcagat cccgcaacag tactgtggag tacagcctaa gcaagctgga acctggaggg      6180
     aaataccaca tcattgtcca gctgggaaac atgagcaagg attccagcat aaaaatcacc      6240
     acagtttcgt tatcagcacc tgatgcctta aaaatcataa cggaaaacga ccacgttctc      6300
     ctcttttgga aaagcctagc actgaaggaa aagcagttca atgaaaccag gggctatgag      6360
     atccacatgt ctgacagcgc tgtgaatctc accgcttacc tcgggaatac tacggacaat      6420
     ttctttaaag tgtccaacct gaagatgggt cataactaca ctttcacggt ccaagcgcgg      6480
     tgtctctttg gtagccagat ctgtggggag cccgccgtgc tgctgtacga tgaactgagc      6540
     tcaggtgcag atgcggcagt gatccaggct gcccggtcta ctgatgttgc agctgtggtg      6600
     gttcccatcc tgttcctgat cctgctgagc ctgggtgtcg gcttcgccat cctctacacg      6660
     aagcaccgtc gcttacaaag cagcttcagc gctttcgcca acagccacta cagctccagg      6720
     ctgggctcgg ccatcttctc ctcaggggat gacctaggag aggacgatga agatgctccc      6780
     atgattactg gattctcaga cgatgtcccc atggtgatag cgtgaagagc ttttctcatt      6840
     agaaaccaaa tggtgtaaat attttatttg ataaagatag ttgatggttt attttaaaag      6900
     atgcactttg agttgcaata tgttattttt atatgggcc                             6939
//


spacer
spacer