spacer

EBI Dbfetch

ID   AK147245; SV 1; linear; mRNA; HTC; MUS; 3143 BP.
XX
AC   AK147245;
XX
DT   06-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 12)
XX
DE   Mus musculus cDNA, RIKEN full-length enriched library, clone:M5C1001N02
DE   product:glycoprotein m6a, full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-3143
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (30-MAR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; ff442c0169708685fcfe184650a8c4b6.
DR   Ensembl-Gn; ENSMUSG00000031517; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000033915; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=M5C1001N02
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3143
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="M5C1001N02"
FT                   /note="pooled tissues: (dev_stage=14 days pregnant
FT                   adult,tissue_type=placenta,sex=female),(dev_stage=adult,
FT                   tissue_type=brain,sex=male,cell_type=undefined_cell_type,
FT                   cell_line=UNDEFINED_CELL_LINE)"
FT                   /db_xref="taxon:10090"
FT   CDS             339..1175
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="glycoprotein m6a (MGD|MGI:107671 GB|NM_153581,
FT                   evidence: BLASTN, 99%, match=3113)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q542P2"
FT                   /db_xref="InterPro:IPR001614"
FT                   /db_xref="InterPro:IPR018237"
FT                   /db_xref="MGI:MGI:107671"
FT                   /db_xref="UniProtKB/TrEMBL:Q542P2"
FT                   /protein_id="BAE27793.1"
FT                   /translation="MEENMEEGQTQKGCFECCIKCLGGIPYASLIATILLYAGVALFCG
FT                   CGHEALSGTVNILQTYFELARTAGDTLDVFTMIDIFKYVIYGIAAAFFVYGILLMVEGF
FT                   FTTGAIKDLYGDFKITTCGRCVSAWFIMLTYLFMLAWLGVTAFTSLPVYMYFNVWTICR
FT                   NTTLVEGANLCLDLRQFGIVTIGEEKKICTASENFLRMCESTELNMTFHLFIVALAGAG
FT                   AAVIAMVHYLMVLSANWAYVKDACRMQKYEDIKSKEEQELHDIHSTRSKERLNAYT"
XX
SQ   Sequence 3143 BP; 886 A; 575 C; 636 G; 1046 T; 0 other;
     gacagtgtct ctgctcctag aatccagacc cctttccact ccccctccca aaattatccg        60
     gctgtttgtt tgagtacctg cttactgtgg cacacacaat gggcagcttt gagaagaaaa       120
     attgataatc ttcacggaag agtaatttga atgaaattac acttgacagc cagtctctaa       180
     gcaaacaaga ggcgcgaggg agcctcagct aagctccaag gacttgccca agccactgct       240
     gctggagctg cccagggaaa aaaggcacac gcttttttga catctaattg agcttttgac       300
     taataccgtg cgccagattc tcctgaagaa aggtagccat ggaagagaat atggaagaag       360
     gacagacaca gaaagggtgc ttcgagtgct gcattaaatg cctgggaggt attccctatg       420
     cttctctgat tgcaaccatc ctgctgtatg caggcgttgc cctgttctgt ggctgtggcc       480
     atgaagccct ttctggaaca gtcaacattc tgcagaccta ctttgagttg gcaaggactg       540
     ctggagacac actggatgtt ttcactatga ttgacatctt taagtatgtg atctatggca       600
     ttgcggctgc tttctttgtc tatggcattt tactgatggt agaaggtttc ttcacaactg       660
     gggctatcaa agatctctat ggagacttca aaatcaccac ctgtggcaga tgtgtgagcg       720
     cttggtttat catgctgaca tacctcttca tgttggcctg gctgggagtc acagctttca       780
     cctcactgcc cgtgtacatg tatttcaatg tgtggaccat ctgccggaac accactctag       840
     tggagggagc aaatctctgc ttggatctgc gtcagtttgg gattgtgaca attggagagg       900
     aaaagaaaat ttgtactgcc tctgagaact tcctgaggat gtgtgaatct actgagctga       960
     atatgacctt ccacttgttc attgtggcac ttgctggagc tggagcagca gttattgcta      1020
     tggtccacta cctgatggtt ctgtctgcca actgggccta tgtgaaagat gcctgccgca      1080
     tgcagaagta cgaagacatc aagtcaaagg aagagcagga gctgcacgac atccattcta      1140
     ctcgctccaa agagcggctc aatgcgtaca cataaatacg cttctctgtt ccttaccact      1200
     cgaaggcatt ggtgtttcat taagggccat ccaaccatcc aacctgtgaa gagcaaaacg      1260
     agaatgctac tcatcaaaga tgcgcagggt gactaatgaa tcacctgagt ataactcttt      1320
     gctgttgagc attccatctt ctaatttgtt aaattggaat gaccaaatct cctctacaag      1380
     ctcctattca gtcttttttt ttaacctctc aaattgattt agttcttctg tatgatcaaa      1440
     gatattaaca ttgtccaacg caaatctttg tttgattttt aatcacctcc cacatatcac      1500
     acataacact ttttgcattg tttcttatgt tttggaagag aaaatagctt ttttatactt      1560
     tttagttttg atttcagtaa ctagtttaac tacaggtaac cttcaaaggg accgttgtac      1620
     attatgaaag agagacagag atggtatcat gatgactccg cttgatatgg gaatcagtct      1680
     ggagagatca gtggccacac ggctatcggc catggttaat gttttcatcc atctaaggtg      1740
     caatttcaaa atttctaagg gtaggttaaa aaaaagtgct tcttatcttt gttaacattg      1800
     tattcttttt tcttgatgtt cgtaaaaggt atttctctga ttactcatgt ttatgttgtg      1860
     agcatgtaga aacagtaatg ctaatgcatg gccagttgcc ttcctaagat tgtgacacca      1920
     ggcttacctt ttcaagttta gtatagaaac aattatcatg gaaataacta ctgtggactg      1980
     ttggagagtg atcttttttt gtgatttatg cagtggctgg attggatctt ttaatatgct      2040
     aatgtggaaa attaattacc tttatgaagg tggtatctta aacataagca cactaaaccc      2100
     tcaagacttg ttttacccac ttaaaacttt taacggattg cacctctgta agctatttct      2160
     taaaatgtgt atgatatatt tgaaaagact tccattaata taatagcttt gcttgcagcc      2220
     ttccaatcta tgttggttta cctgtagtgt ttctaaaggg tggtcagagg ccactagaga      2280
     atgtattgtt tgggagtgta gtgatatata ttttgtgttt ttatttcaag taagtcattt      2340
     taaccaaatg ttcattcaca ttcatttata agaagtacct atatcagaca aattttaaaa      2400
     gaaaaacaat cagtattaat ggaccaaatt tcgtgtttgt tttaaccttg actctctttt      2460
     gattctttct aatgctacaa gaatgctgtg aaatgtcatt taaaataatg atgtagcctg      2520
     acaagaaatt ttgtcagtgt ataaacctag gtagtattgt gcactgattt gaccattgtg      2580
     aattcctcct tcagtgtaag tgcattccca ataaaattta ttgagtgaaa caatctttgt      2640
     acaactacta gtcatgcatc atcagtaatt ttacaagttc ttgtagtagg tagggggtat      2700
     tactagcgtt tctgtggcat gattatgcat tctgtaatat taatttgggg gtccttttgc      2760
     tttttaacac ttagattatc ttaatggttc aacatttttc tgatatatgc agtattaaag      2820
     atattgagca aaagtattaa tgggcttctt taaattctat attatagtgt ttcagttctg      2880
     tgtctacagt gtgtgatgat ttttaaaact gtcttttaaa tttatgtaat gatgttgaca      2940
     ttttgacttt tatttctggt tttagagttt gtattttcat ggagtgcttt gtagcaggca      3000
     ttacaagtaa tctgttttgt acataaatgt gccaacagct tgatggtggc gtttttgaaa      3060
     tgtagaacaa agtgcttgca aaatgtaata aatacacttg tgtactttgt gtacttaaaa      3120
     aaaaaaaaaa aaaaaaaaaa aat                                              3143
//


spacer
spacer