spacer

EBI Dbfetch

ID   AK147160; SV 1; linear; mRNA; HTC; MUS; 2571 BP.
XX
AC   AK147160;
XX
DT   06-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 11)
XX
DE   Mus musculus 16 days embryo kidney cDNA, RIKEN full-length enriched
DE   library, clone:I920192B16 product:LIM domain binding 2, full insert
DE   sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2571
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (30-MAR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 72b5020fcad9a86b655e83aaf78d016f.
DR   Ensembl-Gn; ENSMUSG00000039706; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000070748; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=I920192B16
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2571
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /dev_stage="16 days embryo"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="I920192B16"
FT                   /tissue_type="kidney"
FT                   /db_xref="taxon:10090"
FT   CDS             164..1153
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="LIM domain binding 2 (MGD|MGI:894670 GB|U89489,
FT                   evidence: BLASTN, 98%, match=1955)"
FT                   /note="putative"
FT                   /db_xref="GOA:O55203"
FT                   /db_xref="InterPro:IPR002691"
FT                   /db_xref="InterPro:IPR029005"
FT                   /db_xref="MGI:MGI:894670"
FT                   /protein_id="BAE27725.1"
FT                   /translation="MSSTPHDPFYSSPFGPFYRRHTPYMVQPEYRIYEMNKRLQSRTED
FT                   SDNLWWDAFATEFFEDDATLTLSFCLEDGPKRYTIGRTLIPRYFSTVFEGGVTDLYYIL
FT                   KHSKESYHNSSITVDCDQCAMVTQHGKPMFTKVCTEGRLILEFTFDDLMRIKTWHFTIR
FT                   QYRELVPRSILAMHAQDPQVLDQLSKNITRMGLTNFTLNYLRLCVILEPMQELMSRHKT
FT                   YNLSPRDCLKTCLFQKWQRMVAPPAEPTRQPTTKRRKRKNSTSSTSNSSAGNTTNSAGS
FT                   KKKTPAASLSLATQGLGAIPNCSLNPGRDGDLCHSTAVTPSGQFKEKH"
FT   polyA_signal    2543..2548
FT                   /note="putative"
FT   polyA_site      2571
FT                   /note="putative"
XX
SQ   Sequence 2571 BP; 731 A; 598 C; 565 G; 677 T; 0 other;
     ggccagtgtg ctcagcctgc ctgcctgcct gcctctgtgt gtgtctgtgt gtgtgtgagc        60
     gtgtgtgcgt gcgtctactt tgtactgtga agaacacagc ccatgtgctc tgcatggacg       120
     ttcctgatac tctattaagc ttgattttcg acaagcaggc aagatgtcca gcacaccaca       180
     tgaccccttc tattcttctc ctttcggccc attttatagg agacatacac catacatggt       240
     acagccagag taccgaatct atgagatgaa caagagactg cagtctcgta cagaggacag       300
     tgacaacctc tggtgggatg cgtttgccac tgaatttttt gaagatgatg ccacattaac       360
     actttcattt tgtttggaag acggaccaaa gcgatacact atcggcagga ccctcattcc       420
     ccgttatttt agcaccgtat ttgaaggagg ggtgacagac ctgtactaca tccttaaaca       480
     ctcaaaggag tcatatcaca actcatccat cacagtagac tgcgaccagt gtgccatggt       540
     cacacagcat gggaagccca tgtttaccaa ggtatgcaca gaaggcaggc tgatcttgga       600
     attcacattt gatgacctca tgagaataaa aacgtggcac tttaccatta gacagtacag       660
     ggagctggtc cccagaagca tactagccat gcacgcacaa gatcctcagg tcctggatca       720
     gctgtccaaa aatatcacca ggatgggtct cacaaacttc accctcaact acctcaggtt       780
     gtgtgtaata ctggagccaa tgcaggaact gatgtcgaga cacaaaacct acaacctcag       840
     tccccgagac tgcctgaaga cctgtctgtt tcagaagtgg cagcggatgg tggccccgcc       900
     agcagaaccc acaaggcaac cgacaaccaa aaggagaaaa cgaaaaaact ccacaagcag       960
     cacgtccaat agcagtgccg ggaacacgac caacagtgcc ggcagcaaga agaagacccc      1020
     ggcggcaagc ctgagcctgg ccactcaggg gctaggagcc atcccgaact gcagcctcaa      1080
     ccctgggagg gatggagacc tgtgtcattc aacagcagtg accccttctg gccaatttaa      1140
     ggagaagcat tgaggggccc tgaaaggagt cacttccagt cctcctcaga ggatgtgatg      1200
     gtggtaggag agccaactct gatgggaggt gagtttgggg acgaggacga aaggctaatc      1260
     actagattag aaaacacgca gtatgatgcg gccaacggca tggacgacga agaagacttc      1320
     aacaattcac ctgccctggg gaacaacagc ccgtggaaca gtaaacctcc cgccacgcaa      1380
     gagaccaaat cagaaaacgc cccaccccag gcttcccagt aagatgggct actggcacct      1440
     gattacgctg tccataggcc cgtggggtag aattccattc gcaaatctct actatcagga      1500
     gagaaaagag atgaaattta aaacacacaa gcaaaacgtt tccatgtaaa catctatttc      1560
     taaacttata taatgacctg attttctttc ttgcaatttt tccccctttt taattgagag      1620
     gatcgttcga atgagcctct gtggcctctc cttagaggcc ttcacaagaa gcatagacac      1680
     tgtccctgac ggtaattaga agaagcagag gctcacacat ctcctggcac ggtcttatct      1740
     ccctcgtgtg ttgaacttgc tgtccgtcca tgcaccctac gaaggccatg ctgtgcaaac      1800
     gtgctcagga tctcagtaac gggccaaccc ccaactacag atgacttttt aatattgtaa      1860
     aatattttct gcttttttga cttgcatttg agagtttctt gtttcagtaa aaaaagaaaa      1920
     gaaaagaaaa atatccgttt tggaaaaata acttaaatgc ccctccccgg ccgcctccaa      1980
     tttccattgg tttccatgtg gcaagatccc cgagaaaaca cagctaggtg actttctgac      2040
     aagctgaagc taattggttc ttgaatctga gttgtttcaa tttaggccaa gtactagaac      2100
     aaggaatcat caaagatata tgggtagatt ttattatgta cacaaagaca aatggaccct      2160
     gagaaatgta tgcgtttgta aacttgccat gggtccgaat attttcaagc catgtaatcc      2220
     attaattttg tgggaagctt aataaatcag aagcttttat ttcttcttat tttaattgta      2280
     tcttagttga ctgaattttg gtgaagtttt tttttttttt atgctatatt tcctgtgtaa      2340
     tattttgtaa atccttcacc tgtttctttt atggggactt ttcttttggg gcaagttcag      2400
     tgtatttatg tgaaacttta taagagaact aatttttcca tttgcatatt aatatgttcc      2460
     tctatacatg taaagacaca gtggctctgt gtgtcatcaa gcagctgtat tttatgtatg      2520
     ctttactggt aagtgtgcca ataataaact gtgttaatga ccaaagtaag t               2571
//


spacer
spacer