Dbfetch

ID   AK147137; SV 1; linear; mRNA; HTC; MUS; 3356 BP.
XX
AC   AK147137;
XX
DT   06-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 11)
XX
DE   Mus musculus cDNA, RIKEN full-length enriched library, clone:I920184L03
DE   product:solute carrier family 40 (iron-regulated transporter), member 1,
DE   full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-3356
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (30-MAR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 07b3790f29d2086a4066029fcd5b28c1.
DR   Ensembl-Gn; ENSMUSG00000025993; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0015996; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0015980; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0015935; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0015934; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0015767; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0016387; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0015349; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0015739; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0015840; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0015842; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0015910; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0015862; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0016434; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0015133; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0015410; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000027137; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0019694; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0019671; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0019628; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0019620; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0019449; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0020119; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0018956; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0019403; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0019517; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0019523; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0019605; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0019493; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0020173; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0018713; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0019044; mus_musculus_wsbeij.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=I920184L03
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3356
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="I920184L03"
FT                   /note="pooled tissues: (dev_stage=16 days
FT                   embryo,tissue_type=heart,sex=mix),(dev_stage=16 days
FT                   embryo,tissue_type=kidney,sex=mix),(dev_stage=17 days
FT                   embryo,tissue_type=heart,sex=mix),(dev_stage=17 days
FT                   embryo,tissue_type=stomach,sex=mix),(dev_stage=17 days
FT                   embryo,tissue_type=kidney,sex=mix),(dev_stage=17 days
FT                   pregnant, adult,tissue_type=amnion,sex=female),
FT                   (dev_stage=13 days embryo,tissue_type=liver,sex=mix)"
FT                   /db_xref="taxon:10090"
FT   CDS             318..2030
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="putative"
FT                   /note="solute carrier family 40 (iron-regulated
FT                   transporter), member 1 (MGD|MGI:1315204 GB|NM_016917,
FT                   evidence: BLASTN, 98%, match=3306)"
FT                   /db_xref="GOA:Q9JHI9"
FT                   /db_xref="InterPro:IPR009716"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="MGI:MGI:1315204"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9JHI9"
FT                   /protein_id="BAE27707.1"
FT                   /translation="MTKARDQTHQEGCCGSLANYLTSAKFLLYLGHSLSTWGDRMWHFA
FT                   VSVFLVELYGNSLLLTAVYGLVVAGSVLVLGAIIGDWVDKNARLKVAQTSLVVQNVSVI
FT                   LCGIILMMVFLHKNELLTMYHGWVLTVCYILIITIANIANLASTATAITIQRDWIVVVA
FT                   GENRSRLADMNATIRRIDQLTNILAPMAVGQIMTFGSPVIGCGFISGWNLVSMCVEYFL
FT                   LWKVYQKTPALAVKAALKVEESELKQLTSPKDTEPKPLEGTHLMGEKDSNIRELECEQE
FT                   PTCASQMAEPFRTFRDGWVSYYNQPVFLAGMGLAFLYMTVLGFDCITTGYAYTQGLSGS
FT                   ILSILMGASAITGIMGTVAFTWLRRKCGLVRTGLFSGLAQLSCLILCVISVFMPGSPLD
FT                   LSVSPFEDIRSRFVNVEPVSPTTKIPETVFTTEMHMSNMSNVHEMSTKPIPIVSVSLLF
FT                   AGVIAARIGLWSFDLTVTQLLQENVIESERGIINGVQNSMNYLLDLLHFIMVILAPNPE
FT                   AFGLLVLISVSFVAMGHLMYFRFAQKTLGNQIFVCGPDEKEVTDENQPNTSVV"
XX
SQ   Sequence 3356 BP; 884 A; 709 C; 750 G; 1013 T; 0 other;
     gggcggcggc ggcggcggcg agagcaggct cggggtctcc tgcggccggt ggatcctcca        60
     acccgctccc ataaggcttt ggctttccaa cttcagctac agtgttagct aagtttggaa       120
     agaagacaaa aagaagaccc cgtgacagct ttgctgttgt tgtttgcctt agttgtcctt       180
     tggggtcttt cggcataagg ctgttgtgct tatactggtg ctatcttcgg ttcctctcac       240
     tcctgtgaac aagctcccgg gcaagagcag ctaaagctac cagcatcaga acaaacaagg       300
     ggagaacgcc tggtgtcatg accaaggcaa gagatcaaac ccatcaggaa ggatgctgtg       360
     gatccttagc aaactacctg acctcagcaa aattcctcct ctaccttggc cactctctct       420
     ccacttgggg ggatcggatg tggcactttg cagtgtctgt gtttctggtg gaactctatg       480
     gaaacagcct tctcttgaca gctgtctatg gactggtggt ggcaggctct gttctggtcc       540
     tgggagccat cattggtgac tgggtggata agaatgccag acttaaagtg gcccagacgt       600
     cactggtggt tcagaatgtg tccgtcatcc tctgcggaat catcctgatg atggttttcc       660
     tacacaagaa tgagctcctg accatgtacc atggatgggt ccttactgtc tgctacatcc       720
     tgatcatcac tattgcaaac attgcaaatt tggccagtac tgccactgcg atcacaatcc       780
     aaagggactg gattgttgtt gtggcaggag aaaacaggag cagattagca gacatgaatg       840
     ctaccattag aaggattgac cagctaacca acatcctggc ccccatggct gtcggccaga       900
     ttatgacatt tggttctcca gtcattggct gtggttttat ttccggttgg aatttggtgt       960
     ccatgtgtgt ggagtacttc ttgctctgga aggtttacca gaagacccct gctctggctg      1020
     taaaagctgc tctcaaggta gaggagtcag aactgaagca gctgacctca cctaaagata      1080
     ctgagccaaa acctttggag ggaactcatc taatgggtga gaaagactcc aacatccgtg      1140
     aacttgaatg tgaacaagag cccacctgtg cctcccagat ggcagagccc ttccgcactt      1200
     tccgagatgg atgggtctcc tactataacc agccagtgtt tctggctggc atgggcctgg      1260
     ctttcctcta tatgacagtc ctgggctttg actgtatcac tacagggtac gcctacactc      1320
     aggggctgag tggatccatc cttagtattt tgatgggagc atcagcaata actggaataa      1380
     tgggaactgt ggccttcacc tggctacgtc gaaaatgtgg ccttgttcgg actggtctat      1440
     tctcaggact agcccagctt tcctgtttaa tcttgtgtgt gatctccgta ttcatgcctg      1500
     gaagcccctt ggacctgtct gtttctccat ttgaagatat ccgttctagg tttgtgaatg      1560
     tggagccagt gtccccaact accaaaatac ctgagaccgt ctttacaaca gaaatgcata      1620
     tgtccaacat gtctaatgtc catgagatga gtactaaacc catccccata gtctctgtca      1680
     gcctgctgtt tgcaggagtc attgctgcta gaatcggtct ttggtccttt gatttgacgg      1740
     tgacacagtt gctgcaagaa aatgtaattg aatctgaaag aggcattatc aatggtgtgc      1800
     agaactccat gaactacctt cttgaccttc tgcatttcat catggtcatc ttggccccaa      1860
     atcctgaagc ttttggcttg ctggtattga tttcagtctc ctttgtggca atgggacatc      1920
     ttatgtattt ccgatttgcc cagaagactc tgggcaacca gatttttgtt tgtggtcctg      1980
     atgaaaaaga agttacagat gaaaatcaac cgaatacatc tgttgtataa aaatagttta      2040
     gctgtggccc ctgttactag attgtggaga gcatgtgtgc ttattttgta ctgcagaatc      2100
     ccaataaatg cctgcatttc tctctggttt taccacatct gtgccttaag ggctaggagc      2160
     actaactaac catcgccagc aaagatggtt atttctcctt acatgtaaac attggaaaat      2220
     aggaagaggg agaggcagtc agcgtgtgta taggaagggt ttaatggtaa aatgaacttc      2280
     ccttactctt atgagtatat taaattttaa agagtggttg tcaggtgagt aaaattattc      2340
     cttagcagat atttattatc tactggaatg ataaatcaat tcaccctaaa actcactctt      2400
     gtaaaactct gctccacttc ctttttttta agatcagtga tatttttctc agttacatta      2460
     cagaaacaag tttttcctcc atgtatgaag gttatagtta gataatgaat gttatcctta      2520
     ttaatcccat tgaacttaag gaatttattg tatgtggagg atgaaatgtg taactagact      2580
     tgtccaaaag gttcatggaa taacttttgc attttgacca tcagaaaggg caaaatatta      2640
     cagtaatgtg tgtatggtgg ctcttcataa aatgactctc aaaatctgca gaaagaagaa      2700
     aagttgtagg tttctagtgt ggtacagaag gacttaaagc ttgttattag tgtgattgta      2760
     gaaactggaa gctaagggtg aggacctcat gtaaccagag tcactgtcat cagccatcac      2820
     taactatttt ggtaaatgag agaactgacc tggcacctta caagcagaaa agcggcccac      2880
     actaagaaag gactgcaaat cagtgagtct gtatagaaca ttttaccttc actgacttgg      2940
     gccgatgtgt ttgtcatctc tgtgtttttc tagagcaaga atagtcacaa aagttcccct      3000
     ttcaatatcc ctgagaagaa taaagaaaaa actgtttgta aatatttttt taaaactgtt      3060
     ctgcaagtct ttttgtaaca tgcagtacca acatgggaca ttgccttaac ttttgatgca      3120
     ctttcatgga gactgactgc catgcattgc tgtgagcact ttctttgtcg ttcagtttaa      3180
     tcttttcctt cacctttatt acagtatgac ataatgatct actatgttgt caaagcttca      3240
     taaaatattt ctatataaaa tgtttgtaga atcttcattt gcctttactg agttgtgttc      3300
     tcccaattat tgttacttat ttcaaaatta gcatataaaa agtgtttgat atcatc          3356
//