Dbfetch

ID   AK147112; SV 1; linear; mRNA; HTC; MUS; 3826 BP.
XX
AC   AK147112;
XX
DT   06-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 11)
XX
DE   Mus musculus 17 days embryo kidney cDNA, RIKEN full-length enriched
DE   library, clone:I920170F13 product:protein phosphatase 1, catalytic subunit,
DE   beta isoform, full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-3826
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (30-MAR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; fb798ef059e72c34dfd6278444061da9.
DR   Ensembl-Gn; ENSMUSG00000014956; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029435; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0029401; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0029351; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029412; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0029133; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0029865; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028543; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0029101; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0029250; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0029208; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0029335; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0029237; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0029899; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0028268; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028624; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000015100; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000201360; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0070976; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0071059; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0070960; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0070984; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0070630; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0071464; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0071166; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0070570; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0070707; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0070617; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0070780; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0070642; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0071660; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0070636; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0069787; mus_musculus_wsbeij.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=I920170F13
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3826
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /dev_stage="17 days embryo"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="I920170F13"
FT                   /tissue_type="kidney"
FT                   /db_xref="taxon:10090"
FT   CDS             190..1173
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="protein phosphatase 1, catalytic subunit, beta
FT                   isoform (MGD|MGI:104871 GB|NM_172707, evidence: BLASTN,
FT                   99%, match=2775)"
FT                   /note="putative"
FT                   /db_xref="GOA:P62141"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006186"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR031675"
FT                   /db_xref="MGI:MGI:104871"
FT                   /db_xref="UniProtKB/Swiss-Prot:P62141"
FT                   /protein_id="BAE27684.1"
FT                   /translation="MADGELNVDSLITRLLEVRGCRPGKIVQMTEAEVRGLCIKSREIF
FT                   LSQPILLELEAPLKICGDIHGQYTDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETIC
FT                   LLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRFNIKLWKTFTDCFNCLPIAAI
FT                   VDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDTGLLCDLLWSDPDKDVQGWGENDRGV
FT                   SFTFGADVVSKFLNRHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGM
FT                   MSVDETLMCSFQILKPSEKKAKYQYGGLNSGRPVTPPRTANPPKKR"
FT   regulatory      3804..3809
FT                   /note="putative"
FT                   /regulatory_class="polyA_signal_sequence"
FT   polyA_site      3826
FT                   /note="putative"
XX
SQ   Sequence 3826 BP; 1114 A; 654 C; 788 G; 1270 T; 0 other;
     gtgggcgccg ccagcgtgtg cgcgcgctgt cgctgctcgg cggggagggg gtggggggag        60
     ggcccgcgcc cggggggagt tggagccggg gtcgaaacgc cgcgtgactc gtaggtgaga       120
     acgccgagcc gccgccgccg ccgagaagcc ctgttaacgc tttagggagg agagtctggt       180
     gccgacaaga tggcggacgg ggagctgaac gtggacagcc tcatcacccg cctgctggag       240
     gtacgaggat gtcgtccagg aaagattgta caaatgactg aagcagaagt ccgagggttg       300
     tgtatcaagt ctcgtgaaat ctttctcagc cagcctattc ttttggaatt ggaagcacca       360
     ctgaagattt gtggagacat tcatggacaa tatacagact tactaagatt atttgaatat       420
     ggaggttttc caccagaagc caactatctt ttcttaggag attatgtgga cagaggaaag       480
     cagtctttgg aaaccatctg tttgctattg gcttacaaaa tcaaataccc ggagaacttc       540
     tttcttctaa gaggaaacca tgagtgtgct agcatcaatc gcatttatgg attctacgat       600
     gagtgtaaac gaagatttaa tattaaattg tggaagacat tcactgattg ttttaactgt       660
     ctgcctatag ctgctattgt tgatgagaaa atcttctgtt gtcatggagg actgtcacca       720
     gacctacaat ctatggaaca gattcggaga attatgagac ccactgacgt acctgataca       780
     ggtttgcttt gtgacttact gtggtccgac ccagataagg atgtgcaagg ctggggagaa       840
     aatgaccgtg gtgtttcttt tacttttgga gctgatgtag tcagtaaatt tctgaatcgt       900
     catgatttag acttgatttg tcgagctcat caggtggtgg aagacggata tgaatttttt       960
     gctaaacgac agttggtaac cttattttct gccccaaatt actgtggcga gtttgacaat      1020
     gctggtggta tgatgagtgt ggatgagact ttgatgtgtt cattccagat attgaaacca      1080
     tctgaaaaga aagctaagta ccagtatggt gggctgaatt ctggacgtcc tgtcactccg      1140
     cctcgaacag ctaatccacc gaagaaaagg tgaagacagg aattctagaa agagaaacca      1200
     tcagatttgt taaggacata cttcataata tataagtgtg cactgtaaaa ccatccagcc      1260
     attcgacacc ctttatgatg tcacaccttt aacttaagga gacggtaaag gatcttaaat      1320
     ttttttctaa tagaaagatg tgctacactg tattgtaata agtatactct gttataatat      1380
     tcaacaaaat taaatccaaa ttcaaaagta tccattaaag ttctatcttc tcatatcaca      1440
     gtttttaaag ttgaaaagca tcccagttaa actagccctg ttagtgaccc agatgaaagc      1500
     atgaagatcc atctgtgtaa tgtggtttta gtggtgcttg gttgtttcat tattttgagc      1560
     ttgttttgtt ttgtttgttt ttgctagaat aatggcatct acttttccta tttttcccta      1620
     aacattttta aaagtgaaaa tgggaagagc tttaaagaca ttcaccaact attcttttcc      1680
     tttacttatc tacttaagta actgttggat cttactaaga aaacttaccc ctcattacag      1740
     taaaaaggaa ctttagaggt cgataggttt taaaaatata caaactatct gatccattga      1800
     ttttaatcaa acagtttgac tgggcaaact ttgcagctga taatgagtat ttcgcttttt      1860
     acaaaattgc cactgatttg gatttgtgca ctctaatctt taatttattg atgctctatt      1920
     gtgcagtagc atttcattta agataaggct catatagtaa tatccaaaac tagttggtaa      1980
     tgtgattatg tggtactttg gctttgggtt ctaattcgca cgaaacacct tttggcatgc      2040
     ttaactttct ggtattaccc tcacctgcat tggttttgtt ttttggggtt tttgttgttt      2100
     gtttgttttt agattcacag aacatgagaa tcctttttga caagccttgg atagctggct      2160
     ctcttctttc cctctctcta tgtgaaggat gtatttaaat gaacgctggt cagtgggaca      2220
     tttgtcagct ctgaatattg ggtgcttcac taataattgc catgtgaatg ttgttttgac      2280
     tgtaaggcta tgtcactaaa gatttttact ctgcgttttc ataatcaaag gtcatgatgt      2340
     gtatagacat gctttgtagt gaagtatagt agcaataatt tctgtatgtg atcaagagtt      2400
     tattgcatta tttctttccc tgttctcttt tttttttttt aagggttagc attaacaaat      2460
     gtcaaggagt agcaaagtca acaaagattt tagaaggagg aggaactaag agcatacaca      2520
     gacttatgat tctttggatg tgacacttat tggatgtgat tctaaagtct tttattgaac      2580
     attgtcaaat tcgtacgctt cataggatgg acataatgtt tatataatgc ccttcttatg      2640
     tgttaccata gatgtgtgaa accttatagc gtccttgaaa gtgttaaatt gagaactctg      2700
     ttaacatttt atggattgac acattatatt actgcaagta acatttgatt ttcagcacag      2760
     tgcaaaagtt ctttaaaatg catatgtctt tttttttcta attccatttt gtttaaagca      2820
     cattttaaat gtagttttct catttagtaa aagttgtcta attgatacaa cgtctgagtg      2880
     attattctgt gttgttttgt tttacagtga gatatgtaag cacaagttga catagactga      2940
     agcatagaca gtctctgagc tgtagccatg ttctattagg tcacacatgc ttttatttaa      3000
     tgcgattgga taacttacat actagagtaa acgaacaatt gtttactcaa acaattgcta      3060
     ataggatttt agatgttatc tctgagtaat caatacttaa ggtagctcaa gaaaataagc      3120
     cttagtctca atattagtta atgtacacta atttgtatct taaactgttt tgttttttgt      3180
     aaatgttcat tcaaattaaa actaggggcg aaaagtaagc aaattagtat tggttgttaa      3240
     aggatagaca tttaccatgt tggaaaatta ttcagacctc ttaaaactac tttacagctt      3300
     ctcatatata agtactcagt acatcatgtg ctcctaagaa tgataacaca gattattaat      3360
     tatactagtt tactgacaaa gtcacaaaga caaacagtaa aatacaggct acctttaacc      3420
     ccatgattgg tgaggcagac agagacaggt gaatctatga cttgaagcct agactacatg      3480
     ttacagtgtc tgtttactag atgaaaagct acaagcaatt gcagagaatt tgggttcaat      3540
     tctttttttt tttttttaca cgtattttcc tcaaattaca tttccaatgc tatctcaaaa      3600
     gtcccccaca ccctgggttc tattcttaac actcagaagg ctgtctgtat ggctaagcca      3660
     aggggatctg ctgtcttatg ccctctgagg gcaccaggca cacacatggc acacatggtg      3720
     ggtacataga catacatata ggcaaaatcc tcatacacat aaaaataaaa tgtttaaagg      3780
     atttttttat taagtgttga gcaaataaaa tgagtttttt gattgg                     3826
//