spacer

EBI Dbfetch

ID   AK146860; SV 1; linear; mRNA; HTC; MUS; 2585 BP.
XX
AC   AK146860;
XX
DT   06-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 11)
XX
DE   Mus musculus 16 days embryo kidney cDNA, RIKEN full-length enriched
DE   library, clone:I920066K03 product:LIM domain binding 2, full insert
DE   sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2585
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (30-MAR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; b582ec539c1889b7cf4a3ae7ebbca594.
DR   Ensembl-Gn; ENSMUSG00000039706; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000070748; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=I920066K03
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2585
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /dev_stage="16 days embryo"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="I920066K03"
FT                   /tissue_type="kidney"
FT                   /db_xref="taxon:10090"
FT   CDS             188..1177
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="LIM domain binding 2 (MGD|MGI:894670 GB|U89489,
FT                   evidence: BLASTN, 98%, match=1955)"
FT                   /note="putative"
FT                   /db_xref="GOA:O55203"
FT                   /db_xref="InterPro:IPR002691"
FT                   /db_xref="InterPro:IPR029005"
FT                   /db_xref="InterPro:IPR030174"
FT                   /db_xref="MGI:MGI:894670"
FT                   /db_xref="UniProtKB/Swiss-Prot:O55203"
FT                   /protein_id="BAE27488.1"
FT                   /translation="MSSTPHDPFYSSPFGPFYRRHTPYMVQPEYRIYEMNKRLQSRTED
FT                   SDNLWWDAFATEFFEDDATLTLSFCLEDGPKRYTIGRTLIPRYFSTVFEGGVTDLYYIL
FT                   KHSKESYHNSSITVDCDQCAMVTQHGKPMFTKVCTEGRLILEFTFDDLMRIKTWHFTIR
FT                   QYRELVPRSILAMHAQDPQVLDQLSKNITRMGLTNFTLNYLRLCVILEPMQELMSRHKT
FT                   YNLSPRDCLKTCLFQKWQRMVAPPAEPTRQPTTKRRKRKNSTSSTSNSSAGNTTNSAGS
FT                   KKKTPAASLSLATQGLGAIPNCSLNPGRDGDLCHSTAVTPSGQFKEKH"
FT   regulatory      2566..2571
FT                   /note="putative"
FT                   /regulatory_class="polyA_signal_sequence"
FT   polyA_site      2585
FT                   /note="putative"
XX
SQ   Sequence 2585 BP; 732 A; 608 C; 568 G; 677 T; 0 other;
     gagagggctc ccacagcact tcccagccag tgtgctcagc ctgcctgcct gcctgcctct        60
     gtgtgtgtct gtgtgtgtgt gagcgtgtgt gcgtgcgtct actttgtact gtgaagaaca       120
     cagcccatgt gctctgcatg gacgttcctg atactctatt aagcttgatt ttcgacaagc       180
     aggcaagatg tccagcacac cacatgaccc cttctattct tctcctttcg gcccatttta       240
     taggagacat acaccataca tggtacagcc agagtaccga atctatgaga tgaacaagag       300
     actgcagtct cgtacagagg acagtgacaa cctctggtgg gatgcgtttg ccactgaatt       360
     ttttgaagat gatgccacat taacactttc attttgtttg gaagacggac caaagcgata       420
     cactatcggc aggaccctca ttccccgtta ttttagcacc gtatttgaag gaggggtgac       480
     agacctgtac tacatcctta aacactcaaa ggagtcatat cacaactcat ccatcacagt       540
     agactgcgac cagtgtgcca tggtcacaca gcatgggaag cccatgttta ccaaggtatg       600
     cacagaaggc aggctgatct tggaattcac atttgatgac ctcatgagaa taaaaacgtg       660
     gcactttacc attagacagt acagggagct ggtccccaga agcatactag ccatgcacgc       720
     acaagatcct caggtcctgg atcagctgtc caaaaatatc accaggatgg gtctcacaaa       780
     cttcaccctc aactacctca ggttgtgtgt aatactggag ccaatgcagg aactgatgtc       840
     gagacacaaa acctacaacc tcagtccccg agactgcctg aagacctgtc tgtttcagaa       900
     gtggcagcgg atggtggccc cgccagcaga acccacaagg caaccgacaa ccaaaaggag       960
     aaaacgaaaa aactccacaa gcagcacgtc caatagcagt gccgggaaca cgaccaacag      1020
     tgccggcagc aagaagaaga ccccggcggc aagcctgagc ctggccactc aggggctagg      1080
     agccatcccg aactgcagcc tcaaccctgg gagggatgga gacctgtgtc attcaacagc      1140
     agtgacccct tctggccaat ttaaggagaa gcattgaggg gccctgaaag gagtcacttc      1200
     cagtcctcct cagaggatgt gatggtggta ggagagccaa ctctgatggg aggtgagttt      1260
     ggggacgagg acgaaaggct aatcactaga ttagaaaaca cgcagtatga tgcggccaac      1320
     ggcatggacg acgaagaaga cttcaacaat tcacctgccc tggggaacaa cagcccgtgg      1380
     aacagtaaac ctcccgccac gcaagagacc aaatcagaaa acgccccacc ccaggcttcc      1440
     cagtaagatg ggctactggc acctgattac gctgtccata ggcccgtggg gtagaattcc      1500
     attcgcaaat ctctactatc aggagagaaa agagatgaaa tttaaaacac acaagcaaaa      1560
     cgtttccatg taaacatcta tttctaaact tatataatga cctgattttc tttcttgcaa      1620
     tttttccccc tttttaattg agaggatcgt tcgaatgagc ctctgtggcc tctccttaga      1680
     ggccttcaca agaagcatag acactgtccc tgacggtaat tagaagaagc agaggctcac      1740
     acatctcctg gcacggtctt atctccctcg tgtgttgaac ttgctgtccg tccatgcacc      1800
     ctacgaaggc catgctgtgc aaacgtgctc aggatctcag taacgggcca acccccaact      1860
     acagatgact ttttaatatt gtaaaatatt ttctgctttt ttgacttgca tttgagagtt      1920
     tcttgtttca gtaaaaaaag aaaagaaaag aaaaatatcc gttttggaaa aataacttaa      1980
     atgcccctcc ccggccgcct ccaatttcca ttggtttcca tgtggcaaga tccccgagaa      2040
     aacacagcta ggtgactttc tgacaagctg aagctaattg gttcttgaat ctgagttgtt      2100
     tcaatttagg ccaagtacta gaacaaggaa tcatcaaaga tatatgggta gattttatta      2160
     tgtacacaaa gacaaatgga ccctgagaaa tgtatgcgtt tgtaaacttg ccatgggtcc      2220
     gaatattttc aagccatgta atccattaat tttgtgggaa gcttaataaa tcagaagctt      2280
     ttatttcttc ttattttaat tgtatcttag ttgactgaat tttggtgaag tttttttttt      2340
     tttatgctat atttcctgtg taatattttg taaatccttc acctgtttct tttatgggga      2400
     cttttctttt ggggcaagtt cagtgtattt atgtgaaact ttataagaga actaattttt      2460
     ccatttgcat attaatatgt tcctctatac atgtaaagac acagtggctc tgtgtgtcat      2520
     caagcagctg tattttatgt atgctttact ggtaagtgtg ccaataataa actgtgttaa      2580
     tgacc                                                                  2585
//


spacer
spacer