spacer

EBI Dbfetch

ID   AK146746; SV 1; linear; mRNA; HTC; MUS; 2520 BP.
XX
AC   AK146746;
XX
DT   06-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 11)
XX
DE   Mus musculus 17 days embryo kidney cDNA, RIKEN full-length enriched
DE   library, clone:I920049F10 product:lectin, galactose binding, soluble 8,
DE   full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2520
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (30-MAR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; c8c0cc9b6d2fccecfbf965f28e149a20.
DR   Ensembl-Gn; ENSMUSG00000057554; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000099820; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000099821; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000124888; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=I920049F10
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2520
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /dev_stage="17 days embryo"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="I920049F10"
FT                   /tissue_type="kidney"
FT                   /db_xref="taxon:10090"
FT   CDS             143..1093
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="lectin, galactose binding, soluble 8
FT                   (MGD|MGI:1928481 GB|AK083350, evidence: BLASTN, 99%,
FT                   match=2516)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q542M5"
FT                   /db_xref="InterPro:IPR001079"
FT                   /db_xref="InterPro:IPR008985"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="MGI:MGI:1928481"
FT                   /db_xref="UniProtKB/TrEMBL:Q542M5"
FT                   /protein_id="BAE27406.1"
FT                   /translation="MLSLNNLQNIIYNPIIPYVGTITEQLKPGSLIVIRGHVPKDSERF
FT                   QVDFQLGNSLKPRADVAFHFNPRFKRSSCIVCNTLTQEKWGWEEITYDMPFRKEKSFEI
FT                   VFMVLKNKFQVAVNGRHVLLYAHRISPEQIDTVGIYGKVNIHSIGFRFSSDLQSMETSA
FT                   LGLTQINRENIQKPGKLQLSLPFEARLNASMGPGRTVVIKGEVNTNARSFNVDLVAGKT
FT                   RDIALHLNPRLNVKAFVRNSFLQDAWGEEERNITCFPFSSGMYFEMIIYCDVREFKVAI
FT                   NGVHSLEYKHRFKDLSSIDTLSVDGDIRLLDVRSW"
FT   polyA_signal    2498..2503
FT                   /note="putative"
FT   polyA_site      2520
FT                   /note="putative"
XX
SQ   Sequence 2520 BP; 743 A; 532 C; 565 G; 680 T; 0 other;
     ggggggacac aagtcggagc aaagcgctta ctaccaccgg ggacaagttt ttactttgag        60
     taatccttaa atgaagagtg ggtaaagtgt gtatacggaa gagagactcc aatcaacaat       120
     atcaataagt tgaaaaagaa aaatgttgtc cttaaataac ctacaaaata tcatctataa       180
     cccgataatc ccctatgttg gcaccattac tgagcaattg aagcctggct ctctgattgt       240
     aatccgtggg catgtcccta aagattcaga aagattccag gttgactttc agctgggcaa       300
     cagcctgaag ccaagagcag acgtggcctt ccactttaac cctcggttca aaaggtctag       360
     ctgcattgtt tgtaacacac tgacacagga gaagtggggc tgggaggaga tcacctacga       420
     catgcccttc agaaaagaaa agtcctttga gatcgtgttc atggtgctca agaacaaatt       480
     ccaggtggct gtgaacggaa ggcatgttct gctgtacgcc cacaggatca gcccggagca       540
     gatcgacaca gtgggcatct acggcaaagt gaacatccac tccatcgggt tcagattcag       600
     ctcggattta cagagtatgg aaacatctgc tctgggactg acacagataa acagagagaa       660
     tatacaaaag ccaggcaagc tccagctgag cctgccattt gaagcaaggt tgaatgcctc       720
     catgggtcct ggacgaaccg ttgtcattaa aggggaagtg aacaccaatg cccgaagctt       780
     taatgttgac ctagtggcag gaaaaacaag ggatatcgct ctgcacttga acccacgcct       840
     caatgtgaaa gcatttgtaa gaaattcctt tcttcaggat gcctggggag aagaggagag       900
     aaatattacc tgcttcccat ttagttctgg gatgtacttt gagatgataa tctactgtga       960
     tgtccgggaa ttcaaggttg ctataaatgg tgtgcacagc ctggagtaca aacacagatt      1020
     taaagaccta agcagtattg atacactatc agtcgatggt gatatccgtt tgctggatgt      1080
     aaggagctgg tagctaccat gactgccaaa acccccgaaa tacaaaatgg cttatccggt      1140
     actggccatg tcaaatgcat ctcgctttca ccatattgtt tatattgcta agttgagctc      1200
     ctccaacatc aagtcctact ggtgttgtca ggtctggcca tgcagtacat tcagaggaac      1260
     agagccgggg caatcacagc tcactgccag agaggctctg cacactgggt ccctcttata      1320
     aaccacactc agcaaatatt taagtgccta atatactaca tatactagct aatagggatg      1380
     gcaagcatac ttcctttgta tattctctga gccgggcaca gacatggcag ggcccagaac      1440
     ttgtgtggtc catgttttct agcacttcgt accagttcct ggcctcctaa tgtagggtct      1500
     tcttgctggc attgcattaa ccccactagg ggcctttgca gttaaggtca gaaaaatata      1560
     ctaatggatg gcaaacacta tttccccagc aacccttttc ataatcagca ttctatcata      1620
     tctcataatt gaagactgca tagcatttac ttagctctca ccgctttaaa ctttataaaa      1680
     tgtatgatgc tgaacacagc agaaaaactg aggccaaaac cctgaattat gacaaaacaa      1740
     gtgttctgct ccaagcagat ttctgctggt tgattggcgc tcaagtccag ggtgtgtggg      1800
     tacctgtggc aaagtaaggc agaagttgga taaaccgtgt gtgtaaaacc ctcttggacg      1860
     tatatataaa acaagcacta tcaaagcaaa cccaggggcg tagtgtgaaa ggcttagttg      1920
     gtgtggagac tagccctcgt gcctttgggt ctgaagatgt cggtctgcag cagcagcgag      1980
     gtcaggcaca ttaaaccaca ggacagaatt ctgctggggt ttaggagtat tcagccaatc      2040
     tgcttagata tatgcacttg tgcatatgaa ataataccat cagcagtctt actcaaggca      2100
     gcaactgcta gtccttcatt ttcatgcaaa tttattatgt tcactcttca atatggggtg      2160
     gtgggtggaa ctgggtaatt tgtacggagg ccaggaggct ctagaattct ccagagttat      2220
     gtcttcataa agaatgagtc ttcataaaga atgcactact gagatattgg gggctcaaag      2280
     gcactcagaa aaaaaaaata aaagcctatt catacaacag cttattttca tttctatttt      2340
     tacacaatta agactgattc taagtagatt cagtcttaag ttcttagatt ttttttttta      2400
     aaaagctgct ggaatttagg ttgtgagacc ttctgttgta tattccgaaa ttctatctct      2460
     aaactgcaaa atgccttttt gcttgtccta attctgcatt aaagttttat attaaattgg      2520
//


spacer
spacer