spacer

EBI Dbfetch

ID   AK146002; SV 1; linear; mRNA; HTC; MUS; 2735 BP.
XX
AC   AK146002;
XX
DT   06-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 11)
XX
DE   Mus musculus 12 days pregnant adult female placenta cDNA, RIKEN full-length
DE   enriched library, clone:I530023H01 product:TAR DNA binding protein, full
DE   insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2735
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (30-MAR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; c062cf3955c1861f595375207cf897dc.
DR   Ensembl-Gn; ENSMUSG00000041459; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000084125; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=I530023H01
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2735
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /sex="female"
FT                   /dev_stage="12 days pregnant adult"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="I530023H01"
FT                   /tissue_type="placenta"
FT                   /db_xref="taxon:10090"
FT   CDS             101..1345
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="TAR DNA binding protein (MGD|MGI:2387629
FT                   GB|BC031126, evidence: BLASTN, 100%, match=2727)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q544R5"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="MGI:MGI:2387629"
FT                   /db_xref="UniProtKB/TrEMBL:Q544R5"
FT                   /protein_id="BAE26823.1"
FT                   /translation="MSEYIRVTEDENDEPIEIPSEDDGTVLLSTVTAQFPGACGLRYRN
FT                   PVSQCMRGVRLVEGILHAPDAGWGNLVYVVNYPKDNKRKMDETDASSAVKVKRAVQKTS
FT                   DLIVLGLPWKTTEQDLKDYFSTFGEVLMVQVKKDLKTGHSKGFGFVRFTEYETQVKVMS
FT                   QRHMIDGRWCDCKLPNSKQSPDEPLRSRKVFVGRCTEDMTAEELQQFFCQYGEVVDVFI
FT                   PKPFRAFAFVTFADDKVAQSLCGEDLIIKGISVHISNAEPKHNSNRQLERSGRFGGNPG
FT                   GFGNQGGFGNSRGGGAGLGNNQGGNMGGGMNFGAFSINPAMMAAAQAALQSSWGMMGML
FT                   ASQQNQSGPSGNNQSQGSMQREPNQAFGSGNNSYSGSNSGAPLGWGSASNAGSGSGFNG
FT                   GFGSSMDSKSSGWGM"
FT   polyA_signal    2722..2727
FT                   /note="putative"
FT   polyA_site      2735
FT                   /note="putative"
XX
SQ   Sequence 2735 BP; 727 A; 467 C; 717 G; 824 T; 0 other;
     ggtgggcacg gagcggtagc gcggctgttg tcggattcct tcccgtctgt gcttcctcct        60
     tgtgcttcct agcagtggcc tagcggagat ttaagcaaag atgtctgaat atattcgggt       120
     aacagaagat gagaacgatg aacccattga aataccatca gaagacgatg ggacggtgtt       180
     gctgtccaca gttacagccc agtttccagg ggcatgcggc ctgcgctacc ggaatcccgt       240
     gtctcagtgt atgagaggag tccgactggt ggaaggaatt ctgcatgccc cagatgctgg       300
     ctggggcaat ctggtatatg ttgtcaacta tcccaaagat aacaaaagga aaatggatga       360
     gacagatgct tcctctgcag tgaaagtgaa aagagcagtc cagaaaacat ctgacctcat       420
     agtgttgggt ctcccctgga aaacaactga gcaggatctg aaagactatt tcagtacttt       480
     tggagaggtt cttatggttc aggtcaagaa agatcttaaa actggtcact cgaaagggtt       540
     tggctttgtt cgatttacag aatatgaaac ccaagtgaaa gtaatgtcac aacgacatat       600
     gatagatggg cgatggtgtg actgtaaact tcccaactct aagcaaagcc cagacgagcc       660
     tttgagaagc agaaaggtgt ttgttggacg ttgtacagag gacatgactg ctgaagagct       720
     tcagcagttt ttctgtcagt atggagaagt ggtagatgtc ttcattccca aaccattcag       780
     agcttttgcc ttcgtcacct ttgcagatga taaggttgcc cagtctcttt gtggagagga       840
     tttgatcatt aaaggaatca gcgtgcatat atccaatgct gaacctaagc ataatagcaa       900
     tagacagtta gaaagaagtg gaagatttgg tggtaatcca ggtggctttg ggaatcaggg       960
     tgggtttggt aacagtagag ggggtggagc tggcttggga aataaccagg gtggtaatat      1020
     gggtggaggg atgaactttg gtgcttttag cattaaccca gcgatgatgg ctgcggctca      1080
     ggcagcgttg cagagcagtt ggggtatgat gggcatgtta gccagccagc agaaccagtc      1140
     gggcccatct gggaataacc aaagccaggg cagcatgcag agggaaccaa atcaggcttt      1200
     tggttctgga aataattcct acagtggttc taattctggt gccccccttg gttgggggtc      1260
     agcatcaaat gcaggatcgg gcagtggttt taatgggggc tttggctcga gcatggattc      1320
     taagtcttct ggctggggaa tgtaggtggt ggggggtggt tagtaggttg gttattaggt      1380
     taggtagatt tagaatggtg ggattcaaat ttttctaaac tcatggtaag tatattgtaa      1440
     aatacatatg tactaaaatt ttcagattgg tttgttcagt gtggagtata ttcagcagta      1500
     tttttgacat ttttctttag aaaaaaagag gggaaagcta aatgaatttt ataagttttg      1560
     ttatataaag ggttaaaata ctgagtgggt gaaagtgaac tgctgtttgc ctaattggta      1620
     aaccaacact acaattgatc tcagaaggtt tctctgtaat attctatcat tgaaattgtt      1680
     aatgaattct ttgcatgttc agagtagaaa ccattggtta gaactacatt cttttctcct      1740
     tattttaatt tgaatcccac cctatgaatt ttttccttag gaaaatctcc atttgggaga      1800
     tcatgatgtc atggtgtttg attcttttgg ttttgttttt aacacttgtc ttccttcata      1860
     tacgaaagta caatatgaag ccttcattta atctctgcag ttcatctcat ttcaaatgtt      1920
     tatggaagaa gcacttcatt gaaagtagtg ctgtaaatat tctgccatag gaatacttct      1980
     gtctacatgc tttctcatcc aagaattcgt catcacgctg cacaggctgc gtctttgacg      2040
     gtgggtgttc catttttatc cgctactctt tatttcatgg agtcgtatca acgctatgaa      2100
     cgcaaggctg tgatatggaa ccagaaggct gtttgaactt ttgaaacctt gtgtgggatt      2160
     gatggtggtg ccgaggcatg aaaggctagt atgagcgaga aaaggagagc gcgtgcagag      2220
     acttggtggt ggaaaatgga tattttttaa cttggagaga tgtgtcactc aatcctgtgg      2280
     ctttggtgag agagtgtgca gagagcaatg atagcaaata acgtacgaat gttttacatc      2340
     aaaggacatc cacatcagtt ggaagacttt gagttttgtt cttaggaaac ccactttagt      2400
     tgaatgtgtt aagtgaaata cttgtacttc cctccccctc tgtcaactgc tgtgaatgct      2460
     gtatggtgtg tgttctcctc tgttactgat ctggaagtgt gggaacgtga actgaagctg      2520
     atgggctgcg aacatggact gagcttgtgg tgtgctttgc aggagaactt ggaagcagag      2580
     ttcaccagtg agctcaggtg tctcaaagaa gggtggaagt tctcatgtct gttagctatt      2640
     cataagaatg ctgtttgctg cagttctgtg tcctgtgctt ggatgctttt ttataagagt      2700
     tgtcattgtt ggaaattctt aaataaaact gattt                                 2735
//


spacer
spacer