spacer

EBI Dbfetch

ID   AK145975; SV 1; linear; mRNA; HTC; MUS; 2008 BP.
XX
AC   AK145975;
XX
DT   06-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 11)
XX
DE   Mus musculus 14 days pregnant adult female placenta cDNA, RIKEN full-length
DE   enriched library, clone:I530020D23 product:alpha fetoprotein, full insert
DE   sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2008
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (30-MAR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; f1a7d329aef88d283cea56a34d61c419.
DR   Ensembl-Gn; ENSMUSG00000054932; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000042755; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=I530020D23
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2008
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /sex="female"
FT                   /dev_stage="14 days pregnant adult"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="I530020D23"
FT                   /tissue_type="placenta"
FT                   /db_xref="taxon:10090"
FT   CDS             44..1861
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="alpha fetoprotein (MGD|MGI:87951 GB|AK010934,
FT                   evidence: BLASTN, 99%, match=2007)"
FT                   /note="putative"
FT                   /db_xref="GOA:P02772"
FT                   /db_xref="InterPro:IPR000264"
FT                   /db_xref="InterPro:IPR001703"
FT                   /db_xref="InterPro:IPR014760"
FT                   /db_xref="InterPro:IPR020857"
FT                   /db_xref="InterPro:IPR020858"
FT                   /db_xref="InterPro:IPR021177"
FT                   /db_xref="MGI:MGI:87951"
FT                   /db_xref="UniProtKB/Swiss-Prot:P02772"
FT                   /protein_id="BAE26798.1"
FT                   /translation="MKWITPASLILLLHFAASKALHENEFGIASTLDSSQCVTEKNVLS
FT                   IATITFTQFVPEATEEEVNKMTSDVLAAMKKNSGDGCLESQLSVFLDEICHETELSNKY
FT                   GLSGCCSQSGVERHQCLLARKKTAPASVPPFQFPEPAESCKAHEENRAVFMNRFIYEVS
FT                   RRNPFMYAPAILSLAAQYDKVVLACCKADNKEECFQTKRASIAKELREGSMLNEHVCSV
FT                   IRKFGSRNLQATTIIKLSQKLTEANFTEIQKLALDVAHIHEECCQGNSLECLQDGEKVM
FT                   TYICSQQNILSSKIAECCKLPMIQLGFCIIHAENGVKPEGLSLNPSQFLGDRNFAQFSS
FT                   EEKIMFMASFLHEYSRTHPNLPVSVILRIAKTYQEILEKCSQSGNLPGCQDNLEEELQK
FT                   HIEESQALSKQSCALYQTLGDYKLQNLFLIGYTRKAPQLTSAELIDLTGKMVSIASTCC
FT                   QLSEEKWSGCGEGMADIFIGHLCIRNEASPVNSGISHCCNSSYSNRRLCITSFLRDETY
FT                   APPPFSEDKFIFHKDLCQAQGKALQTMKQELLINLVKQKPELTEEQLAAVTADFSGLLE
FT                   KCCKAQDQEVCFTEEGPKLISKTRDALGV"
FT   polyA_signal    1991..1996
FT                   /note="putative"
FT   polyA_site      2008
FT                   /note="putative"
XX
SQ   Sequence 2008 BP; 588 A; 466 C; 474 G; 480 T; 0 other;
     gatcccactt ccagcactgc ctgcggtgaa ggaaccagca gccatgaagt ggatcacacc        60
     cgcttccctc atcctcctgc tacatttcgc tgcgtccaaa gcattgcacg aaaatgagtt       120
     tgggatagct tccacgttag attcctccca gtgcgtgacg gagaagaatg tgcttagcat       180
     agctaccatc acctttaccc agtttgttcc ggaagccacc gaggaggaag tgaacaaaat       240
     gactagcgat gtgttggctg caatgaagaa aaactctggc gatgggtgtt tagaaagcca       300
     gctatctgtg tttctggatg aaatttgtca tgagacggaa ctctctaaca agtatggact       360
     ctcaggctgc tgcagccaaa gtggagtgga aagacatcag tgtctgctgg cacgcaagaa       420
     gactgctccg gcctctgtcc cacccttcca gtttccagaa cctgccgaga gttgcaaagc       480
     acatgaagaa aacagggcag tgttcatgaa caggttcatc tatgaagtgt caaggaggaa       540
     ccccttcatg tatgccccag ccattctgtc cttggctgct cagtacgaca aggtcgttct       600
     ggcatgctgc aaagctgaca acaaggagga gtgcttccag acaaagagag catccattgc       660
     aaaggaatta agagaaggaa gcatgttaaa tgagcatgta tgttcagtga taagaaaatt       720
     tggatcccga aacctccagg caacaaccat tattaagcta agtcaaaagt taactgaagc       780
     aaattttact gagattcaga agctggccct ggatgtggct cacatccacg aggagtgttg       840
     ccaaggaaac tcgctggagt gtctgcagga tggggaaaaa gtcatgacat atatatgttc       900
     tcaacaaaat attctgtcaa gcaaaatagc agagtgctgc aaattaccca tgatccaact       960
     aggcttctgc ataattcacg cagagaatgg cgtcaaacct gaaggcttat ctctaaatcc      1020
     aagccagttt ttgggagaca gaaattttgc ccaattttct tcagaggaaa aaatcatgtt      1080
     catggcaagc tttcttcatg aatactcaag aactcacccc aaccttcctg tctcagtcat      1140
     tctaagaatt gctaaaacgt accaggaaat attggagaag tgttcccagt ctggaaatct      1200
     acctggatgt caggacaatc tggaagaaga attgcagaaa cacatcgagg agagccaggc      1260
     actgtccaag caaagctgcg ctctctacca gaccttagga gactacaaat tacaaaatct      1320
     gttccttatt ggttacacga ggaaagcccc tcagctgacc tcagcagagc tgatcgacct      1380
     caccgggaag atggtgagca ttgcctccac gtgctgccag ctcagcgagg agaaatggtc      1440
     cggctgtggt gagggaatgg ccgacatttt cattggacat ttgtgtataa ggaatgaagc      1500
     aagccctgtg aactctggta tcagccactg ctgcaactct tcgtattcca acaggaggct      1560
     atgcatcacc agttttctga gggatgaaac ctatgcccct cccccattct ctgaggataa      1620
     attcatcttc cacaaggatc tgtgccaagc tcagggcaaa gccctacaga ccatgaaaca      1680
     agagcttctc attaacctgg tgaagcaaaa gcctgaactg acagaggagc agctggcggc      1740
     tgtcactgca gatttctcgg gccttttgga gaagtgctgc aaagcccagg accaggaagt      1800
     ctgtttcaca gaagagggtc caaagttgat ttccaaaact cgtgatgctt tgggcgttta      1860
     aacatctcca gaaggaagag tggacaaaaa aatgtgttga ctctttggtg tgagcctttt      1920
     ggcttaactg taactgctag tactttaacc acatggtgaa gatgtccatg tgagatttct      1980
     ataccttagg aataaaaact tttcaacc                                         2008
//


spacer
spacer