spacer

EBI Dbfetch

ID   AK145909; SV 1; linear; mRNA; HTC; MUS; 1375 BP.
XX
AC   AK145909;
XX
DT   06-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 11)
XX
DE   Mus musculus 13 days pregnant adult female placenta cDNA, RIKEN full-length
DE   enriched library, clone:I530014D18 product:syntaxin 4A (placental), full
DE   insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1375
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (30-MAR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 2538d0ba98f62922634da4e195e06781.
DR   Ensembl-Gn; ENSMUSG00000030805; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000033075; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000121705; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=I530014D18
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1375
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /sex="female"
FT                   /dev_stage="13 days pregnant adult"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="I530014D18"
FT                   /tissue_type="placenta"
FT                   /db_xref="taxon:10090"
FT   CDS             251..1147
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="putative"
FT                   /note="syntaxin 4A (placental) (MGD|MGI:893577
FT                   GB|NM_009294, evidence: BLASTN, 99%, match=1356)"
FT                   /db_xref="GOA:P70452"
FT                   /db_xref="InterPro:IPR000727"
FT                   /db_xref="InterPro:IPR006011"
FT                   /db_xref="InterPro:IPR006012"
FT                   /db_xref="InterPro:IPR010989"
FT                   /db_xref="MGI:MGI:893577"
FT                   /db_xref="PDB:3PUJ"
FT                   /db_xref="PDB:3PUK"
FT                   /db_xref="UniProtKB/Swiss-Prot:P70452"
FT                   /protein_id="BAE26743.1"
FT                   /translation="MRDRTHELRQGDNISDDEDEVRVALVVHSGAARLGSPDDEFFQKV
FT                   QTIRQTMAKLESKVRELEKQQVTILATPLPEESMKQGLQNLREEIKQLGREVRAQLKAI
FT                   EPQKEEADENYNSVNTRMKKTQHGVLSQQFVELINKCNSMQSEYREKNVERIRRQLKIT
FT                   NAGMVSDEELEQMLDSGQSEVFVSNILKDTQVTRQALNEISARHSEIQQLERSIRELHE
FT                   IFTFLATEVEMQGEMINRIEKNILSSADYVERGQEHVKIALENQKKARKKKVMIAICVY
FT                   VTVLILAVIIGITITVG"
XX
SQ   Sequence 1375 BP; 345 A; 310 C; 446 G; 274 T; 0 other;
     gggggcggca gctgcgggag caggatgggg ggaagagaag ggaattccaa cctgtagaac        60
     tttgggggtc ctatgatcgg gttcttcccc acgactgtgg atggtgaaag gggtggggcc       120
     tttggcggct ccggggtgta ctggagttcg ctgggtgagg gagggggtgt caagagtgag       180
     agaggtgcag gacttccaaa tttagaacct tgaggccctt tgggctcggg tccagggcac       240
     tccgaccacc atgcgcgaca ggacccacga gttgaggcag ggggataaca tctcagacga       300
     tgaagatgag gttcgagtcg cgctggtggt gcactcaggt gctgcccggt tgggcagccc       360
     ggacgacgag ttcttccaga aggtgcagac aattcggcag actatggcca aactggagag       420
     taaagtacgg gagttggaga aacagcaggt caccatcctg gccacgcctc ttcccgagga       480
     gagcatgaag cagggcctgc agaacctgcg agaggagatc aaacagctgg ggagagaggt       540
     cagggcgcag ctaaaagcca tagagcccca gaaggaggaa gctgatgaga attacaactc       600
     agtcaacaca aggatgaaga aaacccagca tggagtcctg tcccagcaat ttgtcgagct       660
     catcaacaag tgcaactcaa tgcagtccga ataccgagag aagaatgtgg agcggatccg       720
     gaggcagctg aagatcacca atgctggaat ggtgtctgac gaggagctgg aacagatgct       780
     ggacagtggg cagagtgagg tgtttgtgtc taatatcctg aaggacacgc aggtgactcg       840
     gcaggccctg aatgagatct ctgcgcggca cagtgagatc cagcagttgg agcgcagtat       900
     ccgagagctc catgagatct ttacgtttct agctacggag gtggagatgc agggggagat       960
     gatcaaccgc atcgagaaga acatcctgag ctcggccgac tacgtggaac gtgggcaaga      1020
     gcacgtcaag atagccctag agaatcagaa gaaggcgagg aagaaaaaag tcatgattgc      1080
     catctgtgtc tatgtcactg ttctcatctt ggctgtcatc attggcatca ccataaccgt      1140
     tggataatgt cacatgttct tggcattggg agagacagag acccagcttt tgtggaggtg      1200
     gggcaggcct ccaactgaac ccgtccgcac actggacctt gtgcagaggg cctgcggctc      1260
     gtcctgggtt ggcagctgct cattcatgga gtcctcccct ggagtcctcc acaatgcctg      1320
     cgagacagtt ttcaatgtcc tgtttgtctg ggatacatgg ttttgtaaaa aattt           1375
//


spacer
spacer