spacer

EBI Dbfetch

ID   AK145881; SV 1; linear; mRNA; HTC; MUS; 2280 BP.
XX
AC   AK145881;
XX
DT   06-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 11)
XX
DE   Mus musculus 13 days pregnant adult female placenta cDNA, RIKEN full-length
DE   enriched library, clone:I530011I21 product:lectin, galactose binding,
DE   soluble 8, full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2280
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (30-MAR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 451d60b38d07432b60b61d0dc9350bdf.
DR   Ensembl-Gn; ENSMUSG00000057554; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000099820; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000099821; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000124888; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=I530011I21
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2280
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /sex="female"
FT                   /dev_stage="13 days pregnant adult"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="I530011I21"
FT                   /tissue_type="placenta"
FT                   /db_xref="taxon:10090"
FT   CDS             134..1084
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="lectin, galactose binding, soluble 8
FT                   (MGD|MGI:1928481 GB|AK083350, evidence: BLASTN, 99%,
FT                   match=2279)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q542M5"
FT                   /db_xref="InterPro:IPR001079"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="MGI:MGI:1928481"
FT                   /db_xref="UniProtKB/TrEMBL:Q542M5"
FT                   /protein_id="BAE26721.1"
FT                   /translation="MLSLNNLQNIIYNPIIPYVGTITEQLKPGSLIVIRGHVPKDSERF
FT                   QVDFQLGNSLKPRADVAFHFNPRFKRSSCIVCNTLTQEKWGWEEITYDMPFRKEKSFEI
FT                   VFMVLKNKFQVAVNGRHVLLYAHRISPEQIDTVGIYGKVNIHSIGFRFSSDLQSMETSA
FT                   LGLTQINRENIQKPGKLQLSLPFEARLNASMGPGRTVVIKGEVNTNARSFNVDLVAGKT
FT                   RDIALHLNPRLNVKAFVRNSFLQDAWGEEERNITCFPFSSGMYFEMIIYCDVREFKVAI
FT                   NGVHSLEYKHRFKDLSSIDTLSVDGDIRLLDVRSW"
XX
SQ   Sequence 2280 BP; 667 A; 495 C; 532 G; 586 T; 0 other;
     gaagtcggag caaagcgctt actaccaccg gggacaagtt tttactttga gtaatcctta        60
     aatgaagagt gggtaaagtg tgtatacgga agagagactc caatcaacaa tatcaataag       120
     ttgaaaaaga aaaatgttgt ccttaaataa cctacaaaat atcatctata acccgataat       180
     cccctatgtt ggcaccatta ctgagcaatt gaagcctggc tctctgattg taatccgtgg       240
     gcatgtccct aaagattcag aaagattcca ggttgacttt cagctgggca acagcctgaa       300
     gccaagagca gacgtggcct tccactttaa ccctcggttc aaaaggtcta gctgcattgt       360
     ttgtaacaca ctgacacagg agaagtgggg ctgggaggag atcacctacg acatgccctt       420
     cagaaaagaa aagtcctttg agatcgtgtt catggtgctc aagaacaaat tccaggtggc       480
     tgtgaacgga aggcatgttc tgctgtacgc ccacaggatc agcccggagc agatcgacac       540
     agtgggcatc tacggcaaag tgaacatcca ctccatcggg ttcagattca gctcggattt       600
     acagagtatg gaaacatctg ctctgggact gacacagata aacagagaga atatacaaaa       660
     gccaggcaag ctccagctga gcctgccatt tgaagcaagg ttgaatgcct ccatgggtcc       720
     tggacgaacc gttgtcatta aaggggaagt gaacaccaat gcccgaagct ttaatgttga       780
     cctagtggca ggaaaaacaa gggatatcgc tctgcacttg aacccacgcc tcaatgtgaa       840
     agcatttgta agaaattcct ttcttcagga tgcctgggga gaagaggaga gaaatattac       900
     ctgcttccca tttagttctg ggatgtactt tgagatgata atctactgtg atgtccggga       960
     attcaaggtt gctataaatg gtgtgcacag cctggagtac aaacacagat ttaaagacct      1020
     aagcagtatt gatacactat cagtcgatgg tgatatccgt ttgctggatg taaggagctg      1080
     gtagctacca tgactgccaa aacccccgaa atacaaaatg gcttatccgg tactggccat      1140
     gtcaaatgca tctcgctttc accatattgt ttatattgct aagttgagct ccttcaacat      1200
     caagtcctac tggtgttgtc aggtctggcc atgcagtaca ttcagaggaa cagagccggg      1260
     gcaatcacag ctcactgcca gagaggctct gcacactggg tccctcttat aaaccacact      1320
     cagcaaatat ttaagtgcct aatatactac atatactagc taatagggat ggcaagcata      1380
     cttcctttgt atattctctg agccgggcac agacatggca gggcccagaa cttgtgtggt      1440
     ccatgttttc tagcacttcg taccagtttc tggcctccta atgtagggtc ttcttgctgg      1500
     cattgcatta accccactag gggcctttgc agttaaggtc agaaaaatat actaatggat      1560
     ggcaaacact acttccccag caaccctttt cataatcagc attctatcat atctcataat      1620
     tgaagactgc atagcattta cttagctctc accgctttaa actttataaa atgtatgatg      1680
     ctgaacacag cagaaaaact gaggccaaaa ccctgaatta tgacaaaaca agtgttctgc      1740
     tccaagcaga tttctgctgg ttgattggcg ctcaagtcca gggtgtgtgg gtacctgtgg      1800
     caaagtaagg cagaagttgg ataaaccgtg tgtgtaaaac cctcttggac gtatatataa      1860
     aacaagcact atcaaagcaa acccaggggc gtagtgtgaa aggcttagtt ggtgtggaga      1920
     ctagccctcg tgcctttggg tctgaagatg tcggtctgca gcagcagcga ggtcaggcac      1980
     attaaaccac aggacagaat tctgctgggg tttaggagta ttcagccaat ctgcttagat      2040
     atatgcactt gtgcatatga aataatacca tcagcagtct tactcaaggc agcaactgct      2100
     agtccttcat tttcatgcaa atttattatg ttcactcttc aatatggggt ggtgggtgga      2160
     actgggtaat ttgtacggag gccaggaggc tctagaattc tccagagtta tgtcttcata      2220
     aagaatgagt cttcataaag aatgcactac tgagatattg ggggctcaaa ggcactcagg      2280
//


spacer
spacer