spacer

EBI Dbfetch

ID   AK145124; SV 1; linear; mRNA; HTC; MUS; 1282 BP.
XX
AC   AK145124;
XX
DT   06-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 11)
XX
DE   Mus musculus mammary gland RCB-0526 Jyg-MC(A) cDNA, RIKEN full-length
DE   enriched library, clone:G830048F21 product:nucleophosmin 1, full insert
DE   sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1282
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (30-MAR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 2a025f0f23a87f127d9175af6f862bd2.
DR   Ensembl-Gn; ENSMUSG00000057113; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000075641; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=G830048F21
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1282
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="G830048F21"
FT                   /cell_line="RCB-0526 Jyg-MC(A)"
FT                   /tissue_type="mammary gland"
FT                   /db_xref="taxon:10090"
FT   CDS             98..976
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="nucleophosmin 1 (MGD|MGI:106184 GB|AK028253,
FT                   evidence: BLASTN, 99%, match=1281)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q5SQB7"
FT                   /db_xref="InterPro:IPR004301"
FT                   /db_xref="InterPro:IPR024057"
FT                   /db_xref="MGI:MGI:106184"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SQB7"
FT                   /protein_id="BAE26248.1"
FT                   /translation="MEDSMDMDMSPLRPQNYLFGCELKADKDYHFKVDNDENEHQLSLR
FT                   TVSLGAGAKDELHIVEAEAMNYEGSPIKVTLATLKMSVQPTVSLGGFEITPPVVLRLKC
FT                   GSGPVHISGQHLVAVEEDAESEDEDEEDVKLLGMSGKRSAPGGGNKVPQKKVKLDEDDE
FT                   DDDEDDEDDEDDDDDDFDEEETEEKVPVKKSVRDTPAKNAQKSNQNGKDLKPSTPRSKG
FT                   QESFKKQEKTPKTPKGPSSVEDIKAKMQASIEKGGSLPKVEAKFINYVKNCFRMTDQEA
FT                   IQDLWQWRKSL"
FT   polyA_signal    1258..1263
FT                   /note="putative"
FT   polyA_site      1282
FT                   /note="putative"
XX
SQ   Sequence 1282 BP; 419 A; 219 C; 313 G; 331 T; 0 other;
     gcttggcgtg attccgtcct gcgcgtctgt tctgtggaac aggaggcagt tgttttccgt        60
     ccggcttctc ccacaccgaa gtgcgcgcct ccacctcatg gaagactcga tggatatgga       120
     catgagtcct cttaggcctc agaactacct tttcggctgt gaactaaagg ctgacaaaga       180
     ctatcacttt aaagtggata atgatgaaaa tgagcaccag ttgtcattaa gaacggtcag       240
     tttaggagca ggggcaaaag atgagttaca catcgtagag gcagaagcaa tgaactatga       300
     aggcagtcca attaaagtaa cactggcaac tttgaaaatg tctgtacaac caacagtttc       360
     ccttgggggc tttgaaatta caccacctgt ggtcttacgg ttgaagtgtg gttcagggcc       420
     tgtgcacatt agtggacagc atctagtagc tgtagaggaa gatgcagagt ctgaagatga       480
     agatgaggag gacgtaaaac tcttaggcat gtctggaaag cgatctgctc ctggaggtgg       540
     taacaaggtt ccacagaaaa aagtaaaact tgatgaagat gatgaggacg atgatgagga       600
     tgatgaggat gatgaggatg atgatgatga tgattttgat gaagaggaaa ctgaagaaaa       660
     ggtcccagtg aagaaatctg tacgagatac cccagccaaa aatgcacaaa aatcaaacca       720
     aaatggaaaa gacttaaaac catcaacacc gagatcaaag ggtcaagagt ccttcaaaaa       780
     acaggaaaag actcctaaaa caccaaaagg acctagttct gtagaagaca ttaaggcaaa       840
     aatgcaagca agtatagaaa aaggcggttc tcttcccaaa gtggaagcca agttcattaa       900
     ttatgtgaag aattgtttcc ggatgactga ccaggaggct attcaagatc tctggcagtg       960
     gaggaaatct ctttaagaaa agggtttaaa cagtttgaaa tattctgtct tcatttctgt      1020
     aatagttaat atctggctgt cctttttata atgcaaagtg agaactttcc ctactgtgtt      1080
     tgataaatgt tgtccaggtt cacttgccaa gaatgtgttg tctaaaatgc ctgtttagtt      1140
     ttcaaggatg gaactccacc ctttacttgg ttttaagtat gtatggaatg ttatgatagg      1200
     acatagtaat agtggtggtc agatgtggaa atggtaggga gacaaatata catgtgaaat      1260
     aaactcagta ttttaataaa gt                                               1282
//


spacer
spacer