spacer

EBI Dbfetch

ID   AK144997; SV 1; linear; mRNA; HTC; MUS; 5127 BP.
XX
AC   AK144997;
XX
DT   06-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 11)
XX
DE   Mus musculus mammary gland RCB-0526 Jyg-MC(A) cDNA, RIKEN full-length
DE   enriched library, clone:G830022G03 product:UDP-Gal:betaGlcNAc beta
DE   1,4-galactosyltransferase, polypeptide 6, full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-5127
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (30-MAR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 604e033dd554e54ec37a3f30137503d4.
DR   Ensembl-Gn; ENSMUSG00000056124; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000070080; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=G830022G03
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..5127
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="G830022G03"
FT                   /cell_line="RCB-0526 Jyg-MC(A)"
FT                   /tissue_type="mammary gland"
FT                   /db_xref="taxon:10090"
FT   CDS             812..1960
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="UDP-Gal:betaGlcNAc beta 1,4-galactosyltransferase,
FT                   polypeptide 6 (MGD|MGI:1928380 GB|NM_019737, evidence:
FT                   BLASTN, 99%, match=4280)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q3UUA9"
FT                   /db_xref="InterPro:IPR003859"
FT                   /db_xref="InterPro:IPR027791"
FT                   /db_xref="InterPro:IPR027995"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="MGI:MGI:1928380"
FT                   /db_xref="UniProtKB/TrEMBL:Q3UUA9"
FT                   /protein_id="BAE26177.1"
FT                   /translation="MSALKRMMRVSNRSLIAFIFFFSLSTSCLYFIYVAPGIANTYLFM
FT                   VQARGIMLRENVKTIGHMIRLYTNKNTTLNGTDYPEGNNTSDYLVQTTTYLPQNFTYLP
FT                   HLPCPEKLPYMRGFLSVNVSEISFDEVHQLFSKDSEIGPGGHWRPKDCKPRWKVAVLIP
FT                   FRNRHEHLPIFFLHLIPMLQKQRLEFAFYVIEQTGTQPFNRAMLFNVGFKEAMKDRAWD
FT                   CVIFHDVDHLPENDRNYYGCGEMPRHFAAKLDKYMYILPYKEFFGGVSGLTVEQFRKIN
FT                   GFPNAFWGWGGEDDDLWNRVHYAGYNVTRPEGDLGKYISIPHHHRGEVQFLGRYKLLRY
FT                   SKERQYIDGLNNLLYTPKILVDRLYTNISVNLMPELAPIEDY"
XX
SQ   Sequence 5127 BP; 1281 A; 1252 C; 1156 G; 1438 T; 0 other;
     ggggtgtccg cggtccgaga tcgcctcgcg tctgtcatct ttttccttcg ccctccgggc        60
     cccggccgtg cgcatccgcc gggtagtccg gggtctgtgc gggggcggcg ccgcctctcc       120
     ctcgggctcc gcggcgggaa tgcggctgct gtggccggct gggcagcggg cggcggcagc       180
     aagcggaacc cgggcgcact cgccgctggc cgggacgccg ccctggcctg cgctccgctc       240
     ccgaggccgc cgttgcgctc cggggcccgg cgcggaatga ggtgcaggcc gcgcgacggc       300
     gagcgccccg ctccgcggcc cccaggttcc ccgcgaccgt ccgtgcctcg cgtgccccgg       360
     tgcccacttt agagcccccg cactagcagc gttcgccaag gcacaggccc gcagagcgca       420
     cgcgacccgg accgggtccc gatcgcgggg actcgcctct tggacgccgc cccgagtgcg       480
     ggtaccccgg cacgctgcag cgcgcgggcc gcactccgca tcgccgagct ccgccagcct       540
     ggcccgtggc tttggcctcc accgagcccg gtctcccggc ctcccttcac gtttctccgc       600
     atccttccaa cacccttccc gctgctccac cgcctcccat tcattgcatc cgtttctcct       660
     tcccggctcg gttcttctcc ccacagcctc cccggccgga ccccgccacc ttcttggggt       720
     tctccgtaca ttcatggaag tttagggcct ggaccgtggc ccggagtctg gcctgagagc       780
     gcagcccgcg ctgctggcag ggcagaggaa gatgtctgcg ctcaagcgga tgatgcgggt       840
     ctccaatcgc tctctgattg ccttcatctt cttcttctcc ctctccacgt cctgtctcta       900
     cttcatctat gtggctccag gcatcgccaa cacgtacctc tttatggtac aagctagagg       960
     tatcatgctg agagagaatg tgaaaacaat tggacacatg atcaggctgt ataccaataa      1020
     aaacactacg ctcaacggaa cagattatcc tgaaggcaat aatacaagtg actatcttgt      1080
     tcaaacaaca acgtatcttc cgcaaaactt cacgtatttg ccacacctcc cctgtccaga      1140
     gaagctgcct tacatgcggg gattcctcag tgtcaatgtg agtgagatca gttttgatga      1200
     agtccatcag ctcttctcca aggactcaga gattgggcca ggaggccact ggaggcccaa      1260
     ggactgcaag cccagatgga aggtggcagt tctcatcccc ttccgtaacc gccatgaaca      1320
     tcttccgatt tttttcctgc acctgattcc gatgctccag aaacagcggc tggaatttgc      1380
     cttttatgtc atcgaacaga ccggcacaca accattcaat cgtgcgatgc tctttaatgt      1440
     gggtttcaaa gaggccatga aagacagagc ctgggactgt gtgatcttcc atgatgtgga      1500
     tcatctgcct gaaaatgatc ggaactacta cggatgtgga gagatgccgc ggcactttgc      1560
     agcgaagctg gacaagtaca tgtacattct tccctataag gagttttttg gtggggtgag      1620
     tggcctgacg gtggagcaat tcaggaagat caacggcttt cccaatgcct tctggggatg      1680
     gggaggcgag gacgatgacc tttggaacag agttcactac gccggctaca atgtaacccg      1740
     gccagaaggg gacttgggaa aatacatatc tattcctcat caccatcgag gggaggtaca      1800
     gttcctagga cggtataaat tacttcggta ttccaaggag cggcagtaca tcgatggact      1860
     gaacaattta ttatacacac ccaaaatact ggttgatagg ctgtatacaa atatatctgt      1920
     aaacctcatg ccagaattag ctccaattga agactattaa aagaagtcat tctcatggtg      1980
     gggtagacca cagtgctgga tcatgaactt ggcttggagt gccctcaccg tggaagttag      2040
     agattggggt gtatctcagt gtcccggtct gtaaaaagag ccagcaatcc ttaatgttta      2100
     cagctcgggc tccatccatc acactctccc actctccccc tgctgggagc gtccccccat      2160
     ggcaagcact gtagagataa gaacccattg cttgggactg gaagtgaaga aaactcccta      2220
     cacagagaag atttttatac tgaaatctat aatttaattc aagagaatgc ttttatttcc      2280
     gttcaaacat attttgtaca tatgtgatgt aaattaaatg tgttcaaatt gttggaaaac      2340
     aagatgtcac aattttgcat gtaattggtt atgccttcat tggactttta tagacatttt      2400
     tttatttgca tggggaaaaa tgtaaattta tgtcgccaaa caaaggttaa gccttgtgtg      2460
     aaatgaaggg actgtcagcg acagacaaag ataatatagt aaccgttctg tactattggt      2520
     gttcagcttt agaccttcag cctcatggca ggaggcacgg tcctctgagg gcttcgaagg      2580
     aaggaaggac tcgcataact tttcttcctg ccacgattac ctgttttgtt ttgtctattt      2640
     tttcccttgc ttgcagtctc atcagatctt gccaagtcaa cagccatatt gtttatgcat      2700
     actgcatgag tattaccaag aaaacctccc agttgtaaag tgacgtgctg tacaggactt      2760
     cttcatgtta aatgtctcta tgtacctccg cgtgtcaggg atcttgtgcc tcaaacgttc      2820
     ctaaggttgt gtttatacac ggttgtgttt atacacggta tatatatttt ttttcaatct      2880
     cataatgaaa acattattat tcccacctta gaagaaccaa aagagggtat cttcttttaa      2940
     aaactttttt tttttgaaag aatgacttta tggaaaatcc agtagtgctt atacagatga      3000
     attatactat tagatgagag attagatgct ctatttttat gaagataaat gcttagatta      3060
     aaacaaactt caactttaat tctcagacat acatggttcc ctttcacatt agctcgtcac      3120
     tcctactgct tttttcactt ttaagaaatc tcatggtgtt atccaatttt ttttcactac      3180
     aagtataatt taatgcctac caccaccacc accaccaccc caccaccacc accaccatgg      3240
     tgctgggtag tgagccgagg gcctatagac ttaccttaca atcattaatt gactgtgtgg      3300
     atattgtgac ttctgctcac cctccacaca cgggtgaggt tttcaatgac cagacaacaa      3360
     caaagcccaa atagtgttct tactttgaaa atgattgatt ataaaaattc ttgaaaaata      3420
     gcctatattc acatgtaaga tcttatctcc catctttaaa caaatttaga acaacatcgt      3480
     ctgtcaagtg aaccctaaga gtgagaattc tggatgtgag aaagtttgct ccccttgtct      3540
     aatgttgaga gcttagcttt cagttgtcat tgtctgtcat agttttggta atgctgatga      3600
     ccacaagtca aaccctacag tgataactaa aattcttgca ccggagaaga cagatgccct      3660
     gtcgtgacag caatctctcc gtgtttattc ttagaattgc ttctaaaata tttacctccc      3720
     aaccttttta gctactcaaa aaagagtgaa aaaaaaaatc tcaacttctg gagatgaaga      3780
     tttttgtatg ttctcagttt atgttctgtc tcctgtggct aatgaagtgt ttaatttgac      3840
     cgaatgacag cagaatgtaa tgttaatgtt aaggcgggtg agacagggct ctttggcccc      3900
     tccttacagt gctgtgggaa gctgtgccgt gtgcaatttt attggaggac acacacttca      3960
     taatgtggcg ggctgtccac agtggggtgc cttttgcatt gatacttagt tcacagtttt      4020
     aggaaaattc agaactggtc atctgcctta ctttcttagg ttaagtctgg tattaatatg      4080
     gcttccggaa ttggatgtaa gtaattttgc tatatcttcg tgttgcatct ggaatgtcag      4140
     cttgtgagaa ccaccttttc taattcagac ctggaattct tttcagtaat gaatagtgac      4200
     ctgggtatgt ttccatggat gacagttttg cctagttacc atgaccacgt gacaataaat      4260
     ctctttctta catattagca caagcaggca gtctgataga atcaaatcta tttggtggct      4320
     ttgcactggg tgtctgtctc ccatccgctg cctggctaac tgtggtattt aaaggcgggt      4380
     tttgtttttt tgttttcttt tttcctaaac aacttaaatc aagaaagttg aaacttatct      4440
     gaaattagaa agaacaccct ctgggaactt atctgttaga tgtcttagtc tcaaatctag      4500
     tgtggtccca gctgctggga ggtccttgtg acattgggga aatgatatgg tgcctttgaa      4560
     ctaaagaaat cgtggctgat ggggagaaag ttcctacatt cattgatttc ccacattcta      4620
     tctgattttc aataaagttg tcatttaatt atttgccaaa actagggttt taatgaggtg      4680
     gcttccacag cccccttttt atatttattt tcagttgtag gcccttgaga tggctcaggg      4740
     tgtaaaggtg cctgcaccaa gcctgacaac ctgcatttga tccctgggac ccacactgta      4800
     gaagtagaga cctcccctta cacagtattc tcagacttcc atatgtgtaa gcgcacacat      4860
     gtacacacac acacagcaaa ttaaaaggta aaagttaaat ttctgtttgt gtcttataga      4920
     aaggtgttca ctaagaaaat attcatgaaa tttaagtaca aaattatcta ttaaaaattc      4980
     ctatcagtca gtcgtggtgg cgcacacctt taatcccagc actcaggagg cagaggcagg      5040
     cggatctctg agttcaaggc cagcctggtc tacagagtta gttccaggac agccaatgct      5100
     acacagagaa accctgtctc aaaaatc                                          5127
//


spacer
spacer