spacer

EBI Dbfetch

ID   AK144780; SV 1; linear; mRNA; HTC; MUS; 3367 BP.
XX
AC   AK144780;
XX
DT   06-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 11)
XX
DE   Mus musculus lung RCB-0558 LLC cDNA, RIKEN full-length enriched library,
DE   clone:G730032N16 product:solute carrier family 40 (iron-regulated
DE   transporter), member 1, full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-3367
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (30-MAR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 58aa8045c9ea267ba5628d12edc03de1.
DR   Ensembl-Gn; ENSMUSG00000025993; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000027137; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=G730032N16
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3367
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="G730032N16"
FT                   /cell_line="RCB-0558 LLC"
FT                   /tissue_type="lung"
FT                   /db_xref="taxon:10090"
FT   CDS             319..2031
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="putative"
FT                   /note="solute carrier family 40 (iron-regulated
FT                   transporter), member 1 (MGD|MGI:1315204 GB|NM_016917,
FT                   evidence: BLASTN, 98%, match=3306)"
FT                   /db_xref="GOA:Q9JHI9"
FT                   /db_xref="InterPro:IPR009716"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="MGI:MGI:1315204"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9JHI9"
FT                   /protein_id="BAE26063.1"
FT                   /translation="MTKARDQTHQEGCCGSLANYLTSAKFLLYLGHSLSTWGDRMWHFA
FT                   VSVFLVELYGNSLLLTAVYGLVVAGSVLVLGAIIGDWVDKNARLKVAQTSLVVQNVSVI
FT                   LCGIILMMVFLHKNELLTMYHGWVLTVCYILIITIANIANLASTATAITIQRDWIVVVA
FT                   GENRSRLADMNATIRRIDQLTNILAPMAVGQIMTFGSPVIGCGFISGWNLVSMCVEYFL
FT                   LWKVYQKTPALAVKAALKVEESELKQLTSPKDTEPKPLEGTHLMGEKDSNIRELECEQE
FT                   PTCASQMAEPFRTFRDGWVSYYNQPVFLAGMGLAFLYMTVLGFDCITTGYAYTQGLSGS
FT                   ILSILMGASAITGIMGTVAFTWLRRKCGLVRTGLFSGLAQLSCLILCVISVFMPGSPLD
FT                   LSVSPFEDIRSRFVNVEPVSPTTKIPETVFTTEMHMSNMSNVHEMSTKPIPIVSVSLLF
FT                   AGVIAARIGLWSFDLTVTQLLQENVIESERGIINGVQNSMNYLLDLLHFIMVILAPNPE
FT                   AFGLLVLISVSFVAMGHLMYFRFAQKTLGNQIFVCGPDEKEVTDENQPNTSVV"
XX
SQ   Sequence 3367 BP; 885 A; 713 C; 753 G; 1016 T; 0 other;
     gggcggcggc ggcggcggcg agagcaggct cggggtctcc tgcggccggt ggatcctcca        60
     acccgctccc ataaggcttt ggctttccaa cttcagctac agtgttagct aagtttggaa       120
     agaagacaaa aagaagaccc cgtgacagct ttggctgttg ttgtttgcct tagttgtcct       180
     ttggggtctt tcggcataag gctgttgtgc ttatactggt gctatcttcg gttcctctca       240
     ctcctgtgaa caagctcccg ggcaagagca gctaaagcta ccagcatcag aacaaacaag       300
     gggagaacgc ctggtgtcat gaccaaggca agagatcaaa cccatcagga aggatgctgt       360
     ggatccttag caaactacct gacctcagca aaattcctcc tctaccttgg ccactctctc       420
     tccacttggg gggatcggat gtggcacttt gcagtgtctg tgtttctggt ggaactctat       480
     ggaaacagcc ttctcttgac agctgtctat ggactggtgg tggcaggctc tgttctggtc       540
     ctgggagcca tcattggtga ctgggtggat aagaatgcca gacttaaagt ggcccagacg       600
     tcactggtgg ttcagaatgt gtccgtcatc ctctgcggaa tcatcctgat gatggttttc       660
     ctacacaaga atgagctcct gaccatgtac catggatggg tccttactgt ctgctacatc       720
     ctgatcatca ctattgcaaa cattgcaaat ttggccagta ctgccactgc gatcacaatc       780
     caaagggact ggattgttgt tgtggcagga gaaaacagga gcagattagc agacatgaat       840
     gctaccatta gaaggattga ccagctaacc aacatcctgg cccccatggc tgtcggccag       900
     attatgacat ttggttctcc agtcattggc tgtggtttta tttccggttg gaatttggtg       960
     tccatgtgtg tggagtactt cttgctctgg aaggtttacc agaagacccc tgctctggct      1020
     gtaaaagctg ctctcaaggt agaggagtca gaactgaagc agctgacctc acctaaagat      1080
     actgagccaa aacctttgga gggaactcat ctaatgggtg agaaagactc caacatccgt      1140
     gaacttgaat gtgaacaaga gcccacctgt gcctcccaga tggcagagcc cttccgcact      1200
     ttccgagatg gatgggtctc ctactataac cagccagtgt ttctggctgg catgggcctg      1260
     gctttcctct atatgacagt cctgggcttt gactgtatca ctacagggta cgcctacact      1320
     caggggctga gtggatccat ccttagtatt ttgatgggag catcagcaat aactggaata      1380
     atgggaactg tggccttcac ctggctacgt cgaaaatgtg gccttgttcg gactggtcta      1440
     ttctcaggac tagcccagct ttcctgttta atcttgtgtg tgatctccgt attcatgcct      1500
     ggaagcccct tggacctgtc tgtttctcca tttgaagata tccgttctag gtttgtgaat      1560
     gtggagccag tgtccccaac taccaaaata cctgagaccg tctttacaac agaaatgcat      1620
     atgtccaaca tgtctaatgt ccatgagatg agtactaaac ccatccccat agtctctgtc      1680
     agcctgctgt ttgcaggagt cattgctgct agaatcggtc tttggtcctt tgatttgacg      1740
     gtgacacagt tgctgcaaga aaatgtaatt gaatctgaaa gaggcattat caatggtgtg      1800
     cagaactcca tgaactacct tcttgacctt ctgcatttca tcatggtcat cttggcccca      1860
     aatcctgaag cttttggctt gctggtattg atttcagtct cctttgtggc aatgggacat      1920
     cttatgtatt tccgatttgc ccagaagact ctgggcaacc agatttttgt ttgtggtcct      1980
     gatgaaaaag aagttacaga tgaaaatcaa ccgaatacat ctgttgtata aaaatagttt      2040
     agctgtggcc cctgttacta gattgtggag agcatgtgtg cttattttgt actgcagaat      2100
     cccaataaat gcctgcattt ctctctggtt ttaccacatc tgtgccttaa gggctaggag      2160
     cactaactaa ccatcgccag caaagatggt tatttctcct tacatgtaaa cattggaaaa      2220
     taggaagagg gagaggcagt cagcgtgtgt ataggaaggg tttaatggta aaatgaactt      2280
     cccttactct tatgagtata ttaaatttta aagagtggtt gtcaggtgag taaaattatt      2340
     ccttagcaga tatttattat ctactggaat gataaatcaa ttcaccctaa aactcactct      2400
     tgtaaaactc tgctccactt ccttttttta agatcagtga tatttttctc agttacatta      2460
     cagaaacaag tttttcctcc atgtatgaag gttatagtta gataatgaat gttatcctta      2520
     ttaatcccat tgaacttaag gaatttattg tatgtggagg atgaaatgtg taactagact      2580
     tgtccaaaag gttcatggaa taacttttgc attttgacca tcagaaaggg caaaatatta      2640
     cagtaatgtg tgtatggtgg ctcttcataa aatgactctc aaaatctgca gaaagaagaa      2700
     aagttgtagg tttctagtgt ggtacagaag gacttaaagc ttgttattag tgtgattgta      2760
     gaaactggaa gctaagggtg aggacctcat gtaaccagag tcactgtcat cagccatcac      2820
     taactatttt ggtaaatgag agaactgacc tggcacctta caagcagaaa agcggcccac      2880
     actaagaaag gactgcaaat cagtgagtct gtatagaaca ttttaccttc actgacttgg      2940
     gccgatgtgt ttgtcatctc tgtgtttttc tagagcaaga atagtcacaa aagttcccct      3000
     ttcaatatcc ctgagaagaa taaagaaaaa actgtttgta aatatttttt taaaactgtt      3060
     ctgcaagtct ttttgtaaca tgcagtacca acatgggaca ttgccttaac ttttgatgca      3120
     ctttcatgga gactgactgc catgcattgc tgtgagcact ttctttgtcg ttcagtttaa      3180
     tcttttcctt cacctttatt acagtatgac ataatgatct actatgttgt caaagcttca      3240
     taaaatattt ctatataaaa tgtttgtaga atcttcattt gcctttactg agttgtgttc      3300
     tcccaattat tgttacttat ttcaaaatta gcatataaaa agtgtttgat atcatcatcg      3360
     ccctttg                                                                3367
//


spacer
spacer