spacer

EBI Dbfetch

ID   AK144585; SV 1; linear; mRNA; HTC; MUS; 1804 BP.
XX
AC   AK144585;
XX
DT   06-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 11)
XX
DE   Mus musculus lung RCB-0558 LLC cDNA, RIKEN full-length enriched library,
DE   clone:G730005I21 product:purinergic receptor P2X, ligand-gated ion channel,
DE   7, full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1804
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (30-MAR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 93a830891ec5e8b2934c7a0beeef24d6.
DR   Ensembl-Gn; ENSMUSG00000029468; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000121489; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=G730005I21
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1804
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="G730005I21"
FT                   /cell_line="RCB-0558 LLC"
FT                   /tissue_type="lung"
FT                   /db_xref="taxon:10090"
FT   CDS             165..1460
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="purinergic receptor P2X, ligand-gated ion channel, 7
FT                   (MGD|MGI:1339957 GB|AJ489297, evidence: BLASTN, 99%,
FT                   match=1291)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q3UN00"
FT                   /db_xref="InterPro:IPR001429"
FT                   /db_xref="InterPro:IPR003050"
FT                   /db_xref="InterPro:IPR027309"
FT                   /db_xref="MGI:MGI:1339957"
FT                   /db_xref="UniProtKB/TrEMBL:Q3UN00"
FT                   /protein_id="BAE25948.1"
FT                   /translation="MPACCSWNDVLQYETNKVTRIQSTNYGTVKWVLHMIVFSYISFAL
FT                   VSDKLYQRKEPVISSVHTKVKGIAEVTENVTEGGVTKLGHSIFDTADYTFPLQGNSFFV
FT                   MTNYVKSEGQVQTLCPEYPRRGAQCSSDRRCKKGWMDPQSKGIQTGRCVPYDKTRKTCE
FT                   VSAWCPTEEEKEAPRPALLRSAENFTVLIKNNIHFPGHNYTTRNILPTMNGSCTFHKTW
FT                   DPQCSIFRLGDIFQEAGENFTEVAVQGGIMGIEIYWDCNLDSWSHHCRPRYSFRRLDDK
FT                   NTDESFVPGYNFRYAKYYKENNVEKRTLIKAFGIRFDILVFGTGGKFDIIQLVVYIGST
FT                   LSYFGLATVCIDLLINTYSSAFCRSGVYPYCKCCEPCTVNEYYYRKKCESIMEPKPTLK
FT                   YVSFVDEPHIRMVDQQLLGKSLQVVKGQEVPT"
XX
SQ   Sequence 1804 BP; 465 A; 458 C; 471 G; 410 T; 0 other;
     gaggacccgc ccccgctgca gtcactggag gaactggaag ttaaccgttc ctgctgagaa        60
     atcggtgtgt ttcctttggc tgctcctagg tgagggtttg ctgtggtcta gcctgggaag       120
     taggtctagc ccaagtccag cctgaacaga gcgagcctgt cgccatgccg gcttgctgca       180
     gctggaacga tgtattgcag tatgagacaa acaaagtcac ccggatccag agcacgaatt       240
     atggcaccgt caagtgggtc ttgcacatga tcgtcttttc ctacattagc tttgctttgg       300
     tgagcgataa gctgtaccag cggaaagagc ctgttatcag ctccgtgcac accaaggtca       360
     aaggcatagc agaggtgacg gagaatgtca cagagggtgg ggtgacgaag ttaggacaca       420
     gcatctttga cactgcagac tacaccttcc ctttgcaggg gaactcattc tttgtcatga       480
     caaactatgt caagtcagaa ggccaagtgc agacgctgtg tcctgagtat cccaggcgcg       540
     gtgcacagtg ctcttctgac cggcgttgta aaaaggggtg gatggaccca cagagcaaag       600
     gaatccagac tggcaggtgt gttccatatg acaagacaag gaagacctgt gaagtctctg       660
     cctggtgtcc tactgaggag gagaaagaag ctccccgacc tgcactcttg aggagcgccg       720
     aaaacttcac cgtactcatc aagaataata tccacttccc cggccacaac tataccacga       780
     gaaacatctt gccaactatg aacggctctt gtacctttca caagacttgg gaccctcagt       840
     gttccatctt ccgactaggg gacatcttcc aggaagcagg agagaacttt acagaggtgg       900
     cagttcaggg aggaatcatg ggtatcgaga tctactggga ttgcaaccta gacagctggt       960
     cccatcactg ccgacccagg tacagcttcc gccgcctgga tgacaagaac acggatgagt      1020
     ccttcgtccc cggctacaac ttcagatatg ccaagtacta taaggagaac aatgtggaaa      1080
     agcggacgtt gatcaaagcc ttcggcatcc gttttgacat cctggttttc ggcactggag      1140
     gaaaatttga catcatccag ctggttgtat acattggatc caccctgtcc tactttggct      1200
     tggccactgt gtgcattgac ttgctcatca acacatactc cagtgctttc tgcaggtcgg      1260
     gggtttaccc ctactgtaag tgctgtgagc cctgcacagt gaacgagtat tactacagaa      1320
     agaagtgtga gtccatcatg gaacccaagc cgacgttgaa gtatgtgtcc tttgtcgacg      1380
     agccgcacat tcgcatggtg gaccagcagc tgcttgggaa aagtctgcaa gttgtcaaag      1440
     gccaagaagt tccaacctag atacttgttt ctcacagaac agagactttg agtattatga      1500
     gatgctttga ctgactctaa gacttgccat tttaaggcgt ctaagatcaa gaagccatgc      1560
     tctcaatgga gagggtgggg ctgaggcacc ttcatgaagg aggcccatgc tcacaagcct      1620
     gacggatgac ctcagacgga tgacctcaga cggatgacct cagacggatg acctcagacg      1680
     gatgacctca gacggatgac ctcagttcca tcctcgggac ccacacagtg gagagagcac      1740
     tgacttccac atgcaagcat ggcatgtgtc cacccccagt ctcccagtaa atgaatttaa      1800
     gtcc                                                                   1804
//


spacer
spacer