spacer

EBI Dbfetch

ID   AK144559; SV 1; linear; mRNA; HTC; MUS; 3107 BP.
XX
AC   AK144559;
XX
DT   06-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 11)
XX
DE   Mus musculus 16 days neonate male diencephalon cDNA, RIKEN full-length
DE   enriched library, clone:G630097E07 product:brain-specific angiogenesis
DE   inhibitor 2, full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-3107
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (30-MAR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 7f301ccefef1331e7724da00ed204445.
DR   Ensembl-Gn; ENSMUSG00000028782; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000106015; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000106017; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000121049; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=G630097E07
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3107
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /sex="male"
FT                   /dev_stage="16 days neonate"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="G630097E07"
FT                   /tissue_type="diencephalon"
FT                   /db_xref="taxon:10090"
FT   CDS             <1..2813
FT                   /codon_start=3
FT                   /transl_table=1
FT                   /note="brain-specific angiogenesis inhibitor 2
FT                   (MGD|MGI:2451244 GB|NM_173071, evidence: BLASTN, 99%,
FT                   match=2823)"
FT                   /note="putative"
FT                   /note="start codon is not identified"
FT                   /db_xref="GOA:Q8CGM1"
FT                   /db_xref="InterPro:IPR000203"
FT                   /db_xref="InterPro:IPR000832"
FT                   /db_xref="InterPro:IPR000884"
FT                   /db_xref="InterPro:IPR001879"
FT                   /db_xref="InterPro:IPR008077"
FT                   /db_xref="InterPro:IPR017981"
FT                   /db_xref="InterPro:IPR022624"
FT                   /db_xref="MGI:MGI:2451244"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8CGM1"
FT                   /protein_id="BAE25937.1"
FT                   /translation="GDLLFSVDILRNVTDTFKRATYVPSADDVQRFFQVVSFMVDSENK
FT                   DKWDDAQQVSPGSVHLLRVVEDFIHLVGDALKAFQSSLIVTDNLVISIQREPISAVSSD
FT                   ITFPMRGRRGMKDWVRHSEDRLFLPKEVLSLSSPGKPATPGAATAGSPGRGRGPGTVPP
FT                   GPGHAHQRLLPADPEESSSYFVIGAVLYRTLGLILPPPRPPLAVTSRVMTVTVRPPTQP
FT                   PAEPLITVELSYIINGTTDPHCASWDYSRADTNSGDWNTESCQTLETQAAHTRCQCQHL
FT                   STFAVLAQPPKDLTLELAGAPSVPLVIGCAVSCMALLTLLAIYAAFWRFIKSERSIILL
FT                   NFCLSILASNILILVGQSRVLSKGVCTMTAAFLHFFFLSSFCWVLTEAWQSYLAVIGRM
FT                   RTRLVRKRFLCLGWGLPALVVAVSVGFTRTKGYGTSSYCWLSLEGGLLYAFVGPAAVIV
FT                   LVNMLIGIIVFNKLMARDGVSDKSKKQRAGSERCPWASLLLPCSACGAVPSPLLSSASA
FT                   RNAMASLWSSCVVLPLLALTWMSAVLAMTDRRSVLFQALFAVFNSAQGFVITAVHCFLR
FT                   REVQDVVKCQMGVCRADESEDSPDSCKNGQLQILSDFEKDVDLACQTVLFKEVNTCNPS
FT                   TITGTLSRLSLDEDEEPKSCLVGPEGGLSFSPLPGNILVPMAASPGLGEPPPPQETDPV
FT                   YMCGEGGLRQLDLTWIRQSEPGSEGDYMVLPRRTLSLQPGGGGTAGEEAPRARPEGTPR
FT                   RAAKTVAHTEGYPSFLSVEHSGLGLGPAYGSLQNPYGMTFQPPPPTPSARQVPEPGERS
FT                   RTMPRTVPGSTMKLGSLERKKLRYSDLDFEVMHTRKRHSELYHELNQKFHTFDRYRSQS
FT                   SAKEKPSPPGGRPGLSQHRRHQSWSTFKSMTLGSLPPKPRERLALHRTAAWEPTEPPDG
FT                   DFQTEV"
FT   polyA_signal    3089..3094
FT                   /note="putative"
FT   polyA_site      3107
FT                   /note="putative"
XX
SQ   Sequence 3107 BP; 578 A; 1008 C; 879 G; 642 T; 0 other;
     gcggggacct gctcttctct gtggacatcc taaggaacgt cactgacacc ttcaagaggg        60
     ccacctatgt cccttccgcc gatgacgtgc agcgtttctt ccaggtggtg agcttcatgg       120
     tggattcaga aaacaaggac aaatgggatg atgctcagca ggtgtcaccg ggctctgtgc       180
     acctgctgcg tgttgtggaa gatttcattc acctcgtggg cgacgctctc aaggccttcc       240
     agagctctct cattgtcacg gacaatctgg tgatcagcat tcagagagag cctatctccg       300
     ccgtgtccag tgacatcacg tttcccatgc ggggccgcag gggcatgaag gactgggtgc       360
     gacactcaga ggatcgtctc tttctaccca aggaggtgct cagcctgtcc tccccaggaa       420
     agccagccac acctggggca gccacagcag gcagcccggg cagggggagg ggcccaggaa       480
     cggtgccccc tggcccaggc cacgcccacc agcgccttct cccagctgac cccgaagagt       540
     cctcctccta ctttgtgatc ggtgctgtgc tctaccgcac ccttggcctc atcctgccgc       600
     cccccaggcc tccacttgct gtcacctccc gggtgatgac agtgactgtg cgtcccccca       660
     cccagcctcc agctgagccc ctcattacag tggaactctc gtacatcatc aatggcacca       720
     ccgatcccca ctgtgccagc tgggactact ccagagcaga taccaactcg ggggactgga       780
     acactgagag ctgccagacc ttggagaccc aggcggctca cacccgctgc cagtgccagc       840
     acctgtccac ctttgccgtc ctggcccagc cacccaagga cctgaccctg gagctggcag       900
     gtgctccctc tgtccccctg gtgatcggct gtgcagtgtc ctgcatggct ctgctcaccc       960
     tgctggccat ctatgcagcc ttctggaggt ttataaaatc agaacgctcc atcatcttgc      1020
     tgaacttctg cctgtccatc ctggcttcca acattctgat cctggtgggc cagtcccggg      1080
     tgctgagcaa gggcgtatgc accatgacgg ctgccttcct acacttcttc tttctgtcct      1140
     ccttttgctg ggtgcttaca gaggcctggc aatcctatct ggctgtcatc gggcggatgc      1200
     gcacccgcct ggttcgcaag cgcttcctct gcctgggctg gggtctacct gccctggtgg      1260
     tggctgtgtc tgttggcttt actcgcacca aaggatatgg tacatccagc tactgctggc      1320
     tgtccctaga gggcggcctg ctctatgcct tcgtgggtcc agcagcagtc attgtcctgg      1380
     tgaacatgct catcgggatt atcgtcttca acaagctcat ggctcgcgat ggcgtctcag      1440
     acaaatctaa gaagcagagg gctgggtcgg agcggtgccc ctgggccagc ctgctccttc      1500
     cctgctcagc gtgtggagcg gtccccagcc ccctgctcag ctcagcctcg gccaggaatg      1560
     ccatggcttc actctggagt tcctgcgtgg tactgcctct cctggcgctt acctggatgt      1620
     ctgccgtcct ggccatgaca gatcgccgct ccgtcctctt ccaggcactc tttgccgttt      1680
     tcaactctgc acaaggcttt gtcatcaccg ctgtgcactg cttcctgcgc cgagaggtcc      1740
     aggatgtggt aaagtgtcag atgggtgtgt gtcgggctga tgagagtgaa gactccccag      1800
     actcgtgcaa gaacgggcag ctgcagatcc tgtcagactt tgaaaaggac gtggatctgg      1860
     cttgtcagac agttctgttc aaggaggtca acacctgcaa cccgtccacc attaccggca      1920
     ctctgtcccg cctgtctctg gatgaggatg aggagcccaa gtcctgtctc gtgggtcctg      1980
     agggtggcct cagcttctca ccactgcctg ggaacatcct ggtacccatg gcagcctcac      2040
     caggtctagg ggagccacca ccaccgcagg agaccgaccc tgtgtacatg tgtggggagg      2100
     gtggcctgcg gcagttggac cttacatgga tacggcagag tgaaccaggc tctgaggggg      2160
     actacatggt tctgccccgg cggactttga gcctgcagcc tggtggtggg ggtacagcgg      2220
     gtgaggaggc cccaagggcc cggcctgagg ggaccccccg gcgggctgcc aaaacggtag      2280
     cccacactga aggctacccc agcttcctgt ctgtggagca ctcgggtcta gggctgggcc      2340
     ctgcctatgg gtctctccag aacccgtatg gaatgacctt ccaaccacca ccaccaacac      2400
     ccagcgcccg ccaagtacca gagccaggag aacgtagccg gaccatgccc cgtacagtgc      2460
     ctggttccac catgaagctg ggctcacttg agcgaaagaa gcttcggtat tcggacttgg      2520
     actttgaggt gatgcacact cggaaacggc actcggaact ctaccacgaa ctcaaccaga      2580
     agttccacac tttcgaccgc taccgtagcc agtcctcagc caaggagaaa cccagccccc      2640
     ccgggggacg ccctggcttg tcccagcaca ggaggcatca aagctggagc accttcaaat      2700
     ctatgacact gggctcactg ccccccaagc cccgagaacg gctggccctg caccggacag      2760
     cagcctggga gcccacagaa ccgccagacg gcgacttcca gacagaggtg tgagtgccac      2820
     gccggactgc ccactgcaca gaaatatata tctattttca cactccactt tggaactacc      2880
     aggagccagc gcccctcccc ctcccgaggc tgggcaggag gcgcagagga ctcagcctgg      2940
     ctgggggcag ccagactggc agggcctggg gggccagggc ccctccttgt tctcagaggt      3000
     cccttagcca cccactggag cctcatcttt gccccggcct gtctgtccct gtcctgggct      3060
     ggggaggggg gagggaaact ttgttgggaa taaacttcac tctgtgg                    3107
//


spacer
spacer