spacer

EBI Dbfetch

ID   AK144386; SV 1; linear; mRNA; HTC; MUS; 1926 BP.
XX
AC   AK144386;
XX
DT   06-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 11)
XX
DE   Mus musculus 13 days embryo spinal cord cDNA, RIKEN full-length enriched
DE   library, clone:G630051A13 product:small nuclear ribonucleoprotein N, full
DE   insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1926
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (30-MAR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; f84ac898b9e2645172903c75643229cc.
DR   Ensembl-Gn; ENSMUSG00000000948; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000059305; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000098402; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=G630051A13
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1926
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /dev_stage="13 days embryo"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="G630051A13"
FT                   /tissue_type="spinal cord"
FT                   /db_xref="taxon:10090"
FT   CDS             466..1188
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="putative"
FT                   /note="small nuclear ribonucleoprotein N (MGD|MGI:98347
FT                   GB|NM_013670, evidence: BLASTN, 99%, match=1306)"
FT                   /db_xref="GOA:Q3UN87"
FT                   /db_xref="InterPro:IPR001163"
FT                   /db_xref="InterPro:IPR006649"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR017131"
FT                   /db_xref="MGI:MGI:98347"
FT                   /db_xref="UniProtKB/TrEMBL:Q3UN87"
FT                   /protein_id="BAE25860.1"
FT                   /translation="MTVGKSSKMLQHIDYRMRCILQDGRIFIGTFKAFDKHMNLILCDC
FT                   DEFRKIKPKNAKQPEREEKRVLGLVLLRGENLVSMTVEGPPPKDTGIARVPLAGAAGGP
FT                   GVGRAAGRGVPAGVPIPQAPAGLAGPVRGVGGPSQQVMTPQGRGTVAAAAVAATASIAG
FT                   APTQYPPGRGTPPPPVGRATPPPGIMAPPPGMRPPMGPPIGLPPARGTPIGMPPPGMRP
FT                   PPPGIRGPPPPGMRPPRP"
FT   polyA_signal    1902..1907
FT                   /note="putative"
FT   polyA_site      1926
FT                   /note="putative"
XX
SQ   Sequence 1926 BP; 540 A; 433 C; 432 G; 521 T; 0 other;
     ggcagagagg agagggagcc ggagatgcca gacgcttggt tctgaggagt gatttgcaac        60
     gcaatggagc gaggaaggga tcgcttacac ttgagaagaa ctactgaaca gcacgtgccc       120
     gaggtcgagg tccaggtcaa acgtcgaagg acagcctcac tgagcaacca agagtgtcac       180
     ttgtacccac gacgttctca gcaacagcaa gttcctgtgg tggatttcca ggcagaacta       240
     agacaggcat tcttagctga gacaccaaga ggtggttaaa gcagtattgc aacttcaagg       300
     tggtggaatt caaggaaaac aggacccatc ctctgtctgt gaaactttgg tcaagcttac       360
     attgtttgtt aatagcctgc atcgaacctt tatttatatc ccttccccga gtattaagga       420
     tcttgaaatt ttagtgttga caacggctat tgtggaacac caatcatgac tgtgggtaag       480
     agtagcaaga tgctgcagca cattgactat aggatgagat gtatcctgca agatgggaga       540
     atcttcattg gcaccttcaa ggcttttgac aagcatatga atttgatcct ctgtgattgt       600
     gatgagttca ggaagatcaa gccaaagaat gcaaaacagc cagaacgtga agaaaaacgg       660
     gttttgggtc tggtcttgct acgtggggag aacttggttt caatgactgt ggagggccca       720
     cctcctaaag atactggcat tgctcgtgtg cctcttgctg gcgctgcagg tggccctggg       780
     gttggaagag cagctggcag aggagtgcca gcaggtgtac ctattcccca ggctcctgct       840
     ggattagcag gccctgtcag aggagttgga ggcccatccc agcaggtcat gaccccacag       900
     ggaagaggca ctgttgcagc tgctgctgtt gctgctactg ctagcattgc aggagcccca       960
     acccagtacc cgccaggacg gggaactcca cctccacctg taggcagagc aaccccacct      1020
     ccaggcatta tggctcctcc acctggtatg agaccaccca tgggcccacc cattgggctt      1080
     ccccctgctc gtgggacacc tataggcatg cctcctccag gaatgagacc ccctccacca      1140
     ggaattagag gcccacctcc cccaggaatg cgcccaccaa gaccctaaga tacagttgat      1200
     aaatctcagc ccttctcttc ccctacaatg cttcttgtga aattgtgtac ctgcaagctt      1260
     tttgacccct cttactgcat taactataga taataaatac atagagcaat tcaattgggg      1320
     ttgttctttg tctgctgatt ttgttaaagt tagagtgaaa ccaaatgtgt ttcagtggtg      1380
     aaattattgt taaagattac tatattaagt ttatattaac taaacacaga tatgacattt      1440
     gctcaagcta ggttcttagg atcagatagt tgaaatattt tcctgatttc tgacattcac      1500
     ttcaagcatt ggttcaaaat cttacagata aggaaaatca agatccattt gctaagattt      1560
     acaagccatt ccggttcaat taaatatgtt tcacttaaag gtgtgtgaag atatttaagc      1620
     agatatttaa attcacatca tttatggcac tggtatgtca ttattgctta tgaattaaaa      1680
     catggaatgc aaggtatttt ccaatcttcc aaacatgctc tattacttag cagtctataa      1740
     ttatgtttac aactatacat acatccatat acacacatac acatgcattc catgcatgca      1800
     tgcgcacaca cacacacaca cacacacaca gacatctatc atgtactggg tctattttgg      1860
     ttttagtttg tacatttgtt taggtgcatt aattggtatt aaataaatta taaaatgatt      1920
     ttcctg                                                                 1926
//


spacer
spacer