Dbfetch

ID   AK143891; SV 1; linear; mRNA; HTC; MUS; 2129 BP.
XX
AC   AK143891;
XX
DT   06-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 11)
XX
DE   Mus musculus adult male kidney cDNA, RIKEN full-length enriched library,
DE   clone:F520004N21 product:hypothetical Lipocalin-1 receptor/LMBR1-like
DE   conserved region containing protein, full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2129
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (30-MAR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 9df39cc2c95a6b72da1a6311e7b466ff.
DR   Ensembl-Gn; ENSMUSG00000022999; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0022317; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0022275; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0022250; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0022282; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0022050; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0022727; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0021573; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0022019; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0022145; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0022125; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0022217; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0022145; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0022742; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0021314; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0021623; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000023736; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000109127; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0042499; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0042459; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0042424; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0042453; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0042187; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0042937; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0042284; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0042098; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0042253; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0042219; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0042322; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0042196; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0042979; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0041870; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0041579; mus_musculus_wsbeij.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=F520004N21
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2129
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /sex="male"
FT                   /dev_stage="adult"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="F520004N21"
FT                   /tissue_type="kidney"
FT                   /db_xref="taxon:10090"
FT   CDS             139..1608
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="hypothetical Lipocalin-1 receptor/LMBR1-like
FT                   conserved region containing protein (InterPro|IPR008075
FT                   InterPro|IPR006876, evidence: InterPro)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q9D1E5"
FT                   /db_xref="InterPro:IPR006876"
FT                   /db_xref="InterPro:IPR008075"
FT                   /db_xref="MGI:MGI:1289247"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9D1E5"
FT                   /protein_id="BAE25586.1"
FT                   /translation="MEAADYEVLSVREQLFHDRVRECIISILLFATLYILCHIFLTRFK
FT                   KPAEFTTVDDEDATVNKIALELCTFTLAVALGAVLLLPFSIISNEVLLSLPRNYYIQWL
FT                   NGSLIHGLWNLVFLFSNLSLVFLMPFAYFFTESEGFAGSRKGVLGRVYETVVMLILLTL
FT                   LVLGMVWVASAIVDNDKASRESLYDFWEYYLPYLYSCISFLGVLLLLVCTPLGLARMFS
FT                   VTGKLLVKPRLLEDLEEQLNCSAFEEAALTRRICNPTSCWLPLDMELLHRQVLALQAQR
FT                   VLLEKRRKASAWQRNLGYPLAMLCLLVLTGLSVLIVAVHILELLIDEAAMPRGMQDAAL
FT                   GQASFSKLGSFGAIIQVVLIFYLMVSSVVGFYSSPLFGSLRPRWHDTSMTQIIGNCVCL
FT                   LVLSSALPVFSRTLGLTRFDLLGDFGRFNWLGNFYIVFLYNAAFAGLTTLCLVKTFTAA
FT                   VRAELIRAFGLDRLPLPVSGFPRASRKKQHQ"
XX
SQ   Sequence 2129 BP; 386 A; 614 C; 603 G; 526 T; 0 other;
     gaccttgagt ttccgtcacg ggcagcgagg agaggcgctt aggctgggtc cgggtgcttg        60
     gcgggcggcg gcggcctcat ccccgctcgt cctccccggg cccggagaca cccccgcccc       120
     agtcatgctg agcagagtat ggaagcagct gactacgaag tgctatccgt gcgagaacag       180
     ctgttccacg acagggtccg cgagtgcatc atctcaatac ttctgtttgc aacactctac       240
     atcctctgcc atatcttcct gacccgcttc aagaagcctg ctgagttcac cacagtggat       300
     gatgaagatg ccacagttaa caagattgcg ctggagctgt gcacctttac cctggcggtc       360
     gccctgggcg ccgtcttact cctgcccttc tccatcatca gcaacgaggt gctgctctcg       420
     ttgccacgca actactacat ccagtggctc aatggctccc tcatccatgg tctgtggaac       480
     ctcgttttcc tcttctccaa tctgtccctc gtcttcctta tgccctttgc atatttcttc       540
     acagagtctg aaggctttgc tggctccaga aagggtgtcc tgggccgggt ctacgagaca       600
     gtggtgatgt tgatcctcct cacgctgctt gtgctgggca tggtgtgggt ggcatccgcc       660
     attgtagaca atgacaaggc cagcagggag tcgctctacg acttctggga gtactacctc       720
     ccctatctct actcctgtat ctccttcctc ggagttctgc tgcttctggt gtgcactcca       780
     ctaggtctcg cccgcatgtt ctctgtcact gggaagttgc tggtcaagcc ccggctactg       840
     gaagacctgg aggaacagct gaactgctca gcctttgagg aggcagctct gactcgaaga       900
     atctgcaatc ccacctcctg ctggctgcca ctggacatgg aactgctgca tagacaggtc       960
     ctggctctgc aggcacagag ggtcctcttg gaaaagcgtc ggaaggcgtc agcctggcaa      1020
     cggaacctgg gctaccctct ggccatgctg tgcttgctgg tgctgacggg cctgtctgtc      1080
     ctcatcgtgg ctgtccacat cctggagctg cttattgacg aggctgccat gccacggggc      1140
     atgcaggatg ctgccctagg ccaggcctcc ttctccaaac tgggatcctt tggcgccatc      1200
     atccaggttg tgctgatatt ttacctgatg gtgtcctcag tggtgggttt ctacagctct      1260
     ccactctttg gaagcctgag gcctaggtgg catgacacat cgatgacaca gatcattggg      1320
     aactgtgtct gcctcctggt cctcagctca gcacttcctg tcttctctag aactcttggc      1380
     ctgacacgct ttgacctgct gggtgacttt ggacgcttca actggctagg caatttctac      1440
     atcgtgttcc tctacaacgc agcctttgct ggcctcacca cactctgtct ggtgaagacc      1500
     ttcacggcag ctgtgagggc agagctgatc cgagcctttg ggctggacag actgccactg      1560
     cctgtctctg ggtttccccg ggcttctagg aagaagcagc atcaatgacc tccagctggg      1620
     ggctgagaag gagagaactg ggcagtgcct aggcctggcg gtgagcccca gggggctgca      1680
     cctcaggacc tggaacctga gagtaggtga cagaggggac ggaccatctg cactgttgct      1740
     taatctgagc cagagtttgg gacccggctg gcctcctgcc ttttcagatg tagctgtggc      1800
     ctgagcatcc atctggtgga gctgggggac tcgctctagt tcctggaccc aaatacgttt      1860
     acacatctat ctgcctcaat cctgttccag gccatgcctg aagccatgtt tacatgattt      1920
     gatgtgcaat agggtgggtg ggacttgggg ggactgggcc aggggtaggt tctggagaca      1980
     ggtcttcctt gcctctggcc cagaagagcc gaagcactgt gctatcctgt ggagggcttt      2040
     ggaccactgg agagaccaag ggtgctggga ggaggcggct gcacccacga gcaataaaat      2100
     tgatcccagg gttttcttgg ttcttttgc                                        2129
//