Dbfetch

ID   AK143679; SV 1; linear; mRNA; HTC; MUS; 1828 BP.
XX
AC   AK143679;
XX
DT   06-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 11)
XX
DE   Mus musculus 6 days neonate spleen cDNA, RIKEN full-length enriched
DE   library, clone:F430009B03 product:Adiponectin receptor protein 1, full
DE   insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1828
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (30-MAR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 5e4d749c4e561a27a05bfad0fcb69799.
DR   Ensembl-Gn; ENSMUSG00000026457; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0016507; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0016490; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0016455; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0016450; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0016276; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0016911; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0015856; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0016249; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0016355; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0016354; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0016426; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0016379; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0016947; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0015642; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0015919; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000027727; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000112237; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0022230; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0022198; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0022166; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0022169; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0021976; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0022682; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0021505; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0021917; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0022046; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0022058; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0022150; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0022029; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0022715; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0021238; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0021553; mus_musculus_wsbeij.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=F430009B03
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1828
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /dev_stage="6 days neonate"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="F430009B03"
FT                   /tissue_type="spleen"
FT                   /db_xref="taxon:10090"
FT   CDS             630..1757
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="Adiponectin receptor protein 1 (UniProt|Q91VH1,
FT                   evidence: FASTY, 100%ID, 100%length, match=1125)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q53YY4"
FT                   /db_xref="InterPro:IPR004254"
FT                   /db_xref="MGI:MGI:1919924"
FT                   /db_xref="UniProtKB/TrEMBL:Q53YY4"
FT                   /protein_id="BAE25492.1"
FT                   /translation="MSSHKGSAGAQGNGAPSGNREADTVELAELGPLLEEKGKRAASSP
FT                   AKAEEDQACPVPQEEEEEVRVLTLPLQAHHAMEKMEEFVYKVWEGRWRVIPYDVLPDWL
FT                   KDNDYLLHGHRPPMPSFRACFKSIFRIHTETGNIWTHLLGFVLFLFLGILTMLRPNMYF
FT                   MAPLQEKVVFGMFFLGAVLCLSFSWLFHTVYCHSEKVSRTFSKLDYSGIALLIMGSFVP
FT                   WLYYSFYCSPQPRLIYLSIVCVLGISAIIVAQWDRFATPKHRQTRAGVFLGLGLSGVVP
FT                   TMHFTIAEGFVKATTVGQMGWFFLMAVMYITGAGLYAARIPERFFPGKFDIWFQSHQIF
FT                   HVLVVAAAFVHFYGVSNLQEFRYGLEGGCTDDSLL"
XX
SQ   Sequence 1828 BP; 324 A; 556 C; 555 G; 393 T; 0 other;
     ggcggtcgcg cggcccttcc ggcgcgggca gggcgctgag gatcgggcgc ccctcggccg        60
     caggccgcct ccagtgccgc gggatgtagc gcccgggccc gcggccccca gcagaggcag       120
     ccagccaggc cgtaagtgtc ccgggggtgg gcggggcgcg ggccctgcag gctctggagg       180
     ggacagcacg ggagtggccc gcccctggat cgtcgctcac cgcccggccc tccgaaaggt       240
     cctccgtaaa catttccggc ccctcccacc gcgcaccgcc tccgttcggg gggctgctcg       300
     ccgccgtcgg ggcccggcag tccgcgagtg ctgtctccgc agccgcgcgg tagacggccg       360
     cgttccagcc ctgctggcga cccccggagt tgagcctgcg agttgggtgc gggaacaccg       420
     gccctgggtg gccgggaacc ctaaggccac caccgcgatc cgcaggtcaa acgtgacggg       480
     gctccctcct ggatagggtc ggtcgggaag ttgatggaga ctcgacaggc ctaagtgtcc       540
     accatcacag gaagatctct gccctctggg gctgagagac cccaaccttt cttcaagctg       600
     aagctgccag gcactgaggt accagccaga tgtcttccca caaaggctct gccggggcac       660
     aaggcaatgg ggctccttct ggtaacagag aagctgacac agtggagctg gctgagctgg       720
     ggcccctgct ggaggagaag ggcaagcggg cagccagcag cccagccaag gctgaggaag       780
     atcaagcatg cccggtgcct caggaagagg aggaggaggt gcgggtgctg acgcttcctc       840
     tgcaagccca ccatgccatg gagaagatgg aggagttcgt gtataaggtc tgggagggac       900
     gttggagagt catcccgtat gatgtgcttc ctgactggct gaaagacaac gactacctgc       960
     tacatggcca cagaccacct atgccctcct ttcgggcttg cttcaagagc atcttccgca      1020
     tccacacaga gactggcaac atctggacac atctgcttgg ttttgtgcta tttctctttc      1080
     tgggaatctt gacgatgctg agaccaaata tgtacttcat ggctcccctg caggagaagg      1140
     tggtcttcgg gatgttcttc ctgggcgcgg tgctctgcct cagtttctcc tggctcttcc      1200
     acactgtcta ctgtcattca gagaaggtct ctcggacttt ttccaaactg gactattcag      1260
     ggattgctct actgattatg gggagcttcg ttccctggct ctattactcc ttctactgct      1320
     ccccacagcc gcggctcatc tacctctcca tcgtctgtgt cctgggcatc tctgccatca      1380
     ttgtggcaca gtgggaccgg tttgccactc ccaagcaccg gcagacaaga gcaggagtgt      1440
     tcctgggact tggcttgagt ggtgttgtac ccaccatgca ctttactatc gctgagggct      1500
     ttgtcaaggc caccacggtg ggccagatgg gctggttctt cctcatggct gtgatgtaca      1560
     tcaccggcgc cggcctgtat gctgctcgga ttcctgagcg cttcttccct ggaaaatttg      1620
     acatctggtt ccagtctcat cagattttcc acgtcctggt ggtggcagca gctttcgtcc      1680
     acttctatgg tgtgtccaac cttcaggaat tccgttatgg cctagaaggt ggctgtaccg      1740
     acgactccct tctctgagcc tccccacctg aggggtggag gagggacttc ccaagtgctt      1800
     taaaaaataa cttctttgct gaagtacg                                         1828
//