spacer

EBI Dbfetch

ID   AK143101; SV 1; linear; mRNA; HTC; MUS; 4164 BP.
XX
AC   AK143101;
XX
DT   06-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 11)
XX
DE   Mus musculus 0 day neonate eyeball cDNA, RIKEN full-length enriched
DE   library, clone:E130102K05 product:frizzled homolog 1 (Drosophila), full
DE   insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-4164
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (30-MAR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 22b9543a17f4a0077e5cd46f001c0c0e.
DR   Ensembl-Gn; ENSMUSG00000044674; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000054294; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=E130102K05
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4164
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /dev_stage="0 day neonate"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="E130102K05"
FT                   /tissue_type="eyeball"
FT                   /db_xref="taxon:10090"
FT   CDS             457..2385
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="frizzled homolog 1 (Drosophila) (MGD|MGI:1196625
FT                   GB|NM_021457, evidence: BLASTN, 99%, match=4099)"
FT                   /note="putative"
FT                   /db_xref="GOA:O70421"
FT                   /db_xref="InterPro:IPR000539"
FT                   /db_xref="InterPro:IPR015526"
FT                   /db_xref="InterPro:IPR017981"
FT                   /db_xref="InterPro:IPR020067"
FT                   /db_xref="InterPro:IPR026548"
FT                   /db_xref="MGI:MGI:1196625"
FT                   /db_xref="UniProtKB/Swiss-Prot:O70421"
FT                   /protein_id="BAE25269.1"
FT                   /translation="MAEEAAPSESRAAGRLSLELCAEALPGRREEVGHEDTASHRRPRA
FT                   DPRRWASGLLLLLWLLEAPLLLGVRAQAAGQVSGPGQQAPPPPQPQQSGQQYNGERGIS
FT                   IPDHGYCQPISIPLCTDIAYNQTIMPNLLGHTNQEDAGLEVHQFYPLVKVQCSAELKFF
FT                   LCSMYAPVCTVLEQALPPCRSLCERARQGCEALMNKFGFQWPDTLKCEKFPVHGAGELC
FT                   VGQNTSDKGTPTPSLLPEFWTSNPQHGGGGYRGGYPGGAGTVERGKFSCPRALRVPSYL
FT                   NYHFLGEKDCGAPCEPTKVYGLMYFGPEELRFSRTWIGIWSVLCCASTLFTVLTYLVDM
FT                   RRFSYPERPIIFLSGCYTAVAVAYIAGFLLEDRVVCNDKFAEDGARTVAQGTKKEGCTI
FT                   LFMMLYFFSMASSIWWVILSLTWFLAAGMKWGHEAIEANSQYFHLAAWAVPAIKTITIL
FT                   ALGQVDGDVLSGVCFVGLNNVDALRGFVLAPLFVYLFIGTSFLLAGFVSLFRIRTIMKH
FT                   DGTKTEKLEKLMVRIGVFSVLYTVPATIVIACYFYEQAFRDQWERSWVAQSCKSYAIPC
FT                   PHLQGGGGVPPHPPMSPDFTVFMIKYLMTLIVGITSGFWIWSGKTLNSWRKFYTRLTNS
FT                   KQGETTV"
XX
SQ   Sequence 4164 BP; 868 A; 1166 C; 1166 G; 964 T; 0 other;
     ggttggaggg cgcgcgaggg agagcagagg ctgcgagttg agggattgac acaaatggtc        60
     aggcggcggc ggagaaggag gaggcggagg cgcagggggg acccagggcg gctaggctgc       120
     cgagagttgg gcgctcctct gcccggctgc gaccactaac gcggcgccgc ctgacaagag       180
     ccacagcctg ccgcgggcca gggaagaggg acgcgacccc ggcgcgcctg gaccactctt       240
     gctctcctcg ccgcccgcgc ttcatgaacc gcaagtttcc gcggcggcgg cggcggctgc       300
     gggacgcgga gcagaatccc ggggagcggg cagagagcgg ccgcaccccg acggagggca       360
     cgggcgacca gctctcccgg atcacagtgg gagccaccac ccgccgcgcc gctgcccgtc       420
     ccagtcaatc cgcgccgagg agggagccga aaaagtatgg ctgaggaggc ggcgcctagc       480
     gagtcccggg ccgccggccg gctgagcttg gaactttgtg ccgaagcact cccgggccgg       540
     cgggaggagg tggggcacga ggacacggcc agccaccgcc gcccccgggc tgatccccgg       600
     cgttgggcta gcgggctgct gctgctgctt tggttgctgg aggctcctct gcttttgggg       660
     gtccgagcgc aggcggcggg ccaggtatcc gggccgggcc agcaagcccc gccgccgccc       720
     cagccccagc agagcgggca gcagtacaac ggcgaacggg gcatctccat cccggaccac       780
     ggctactgcc agcccatctc catcccgctg tgcacggaca tcgcgtacaa ccagaccatc       840
     atgcccaacc tgctgggcca cacgaatcag gaggacgccg gtctggaggt gcaccagttc       900
     taccctctgg tgaaggtgca gtgctccgcc gagctcaagt tcttcctgtg ctccatgtac       960
     gcgcctgtgt gcaccgtact ggagcaggcg ctaccgccct gccgctccct gtgcgagcgc      1020
     gcacgccagg gctgcgaggc gctcatgaac aagttcggct tccagtggcc agacacactc      1080
     aagtgcgaga agttcccggt gcacggcgca ggagagctgt gcgtgggcca gaacacgtcc      1140
     gacaaaggca ccccaactcc ctccttgcta ccagagttct ggaccagtaa tccgcagcac      1200
     ggcggcggtg gttaccgcgg cggctacccg gggggtgccg ggacggtgga gcggggaaag      1260
     ttctcctgcc cgcgcgccct cagggtgccc tcctacctca actaccactt tctgggggag      1320
     aaggactgcg gcgcaccctg cgaacccacc aaggtttacg ggctcatgta cttcgggcca      1380
     gaggagctgc gcttctcgcg cacctggata ggcatctggt ccgtgctgtg ctgcgcctcc      1440
     acgctcttca cggtgctcac gtacctagtg gacatgcggc gcttcagcta cccggaacgg      1500
     cccatcattt tcctgtccgg ctgttacaca gcggtggcgg tggcctacat cgctggcttt      1560
     ctgttggagg accgggtggt gtgcaacgac aagtttgcag aggacggggc gcgcacggtg      1620
     gcgcagggca ctaagaaaga aggctgcact atactcttta tgatgctcta cttcttcagc      1680
     atggccagct ccatctggtg ggtgatcctg tccctcacct ggttcctggc agccggcatg      1740
     aagtggggcc acgaagccat cgaggccaac tcacagtatt tccatttagc cgcctgggct      1800
     gtgccagcca tcaaaactat aaccatcttg gcgttgggcc aggtggatgg cgacgtactg      1860
     agcggagtgt gttttgtggg gctcaacaac gtggacgcac tgcgtggctt tgtgctggcg      1920
     cctctcttcg tttatctgtt cattggcact tctttcctgc tggccggttt cgtgtcactc      1980
     ttccgcatcc gcaccatcat gaagcatgac ggcaccaaga cagagaagct ggagaagctc      2040
     atggtgcgca tcggagtctt cagtgtcctc tacactgtgc cggccaccat cgtcatcgcc      2100
     tgctacttct atgaacaggc ctttcgggac cagtgggagc gcagctgggt ggcccagagc      2160
     tgcaagagtt atgccatccc ttgccctcac ctccagggag gtggaggagt cccaccacac      2220
     ccgcccatga gcccagactt tacagtcttc atgatcaagt atctcatgac gctgattgtg      2280
     ggcatcacat cgggcttctg gatctggtcc ggcaagacac tgaattcctg gaggaagttc      2340
     tacacgaggc ttaccaacag caaacagggg gagactaccg tctgaaaccc agactcttac      2400
     cttacccttt tttggcctga tcctagccat cgcctggaag ctggccccaa ggaattcctg      2460
     ccaagcctgg ccactccagg cttcctcgcc agccactgac ttttgcaggc ccctttccca      2520
     acaaacagca caggttctgc aaaagcttcc gtccctgggg taaaggaacg agagggccca      2580
     actgatcgag gtgtatgtgt atgtgcgtgt ggaccgatct ctctagccct ctctgatacc      2640
     aggattgtac gcttttatga ttgtaaatag cctgtgtaag atttttgtac gtatatttgt      2700
     atttaaagac tatcgaacac gcagtttttt tttcttttta aaaatgttta attatttagg      2760
     gcaatttacg tatttggagc ttttctcact tgcccttttc tgcagattgc agaggaggta      2820
     aaacagagca cacttgacta agtgctttgc cctgtgccct catctttgtc aagggagcat      2880
     gggcctgcct ctccagggtc atttccttca gcatctcccg cccctcccct tccttgcttg      2940
     cagtgggaaa ttttaaggtg cagaactctg taaagcttcc agatcccgag gtgggccccg      3000
     cccattccag atcctcccct tttcagcggt agagtgtgga tggctgtccc tgtgacttcc      3060
     tgatgctgct tatttgagat ccaccttcca gctttattag aggaccccag tatgggctct      3120
     gccagttgac ccagcctccc tgtaccccgg tgtcccttgc ccagtgtctt tctccttgca      3180
     cctaagttgt tcagagggag tgcagtaacc gaccgatagc gaactttgga gagtctgact      3240
     ttttatggat gagctcattt ttactctcta gtatctggaa cttgctctgg gtctggtcat      3300
     catcatggaa agagcagcaa gctttgtggg ttgggagagg ctaaagagag aggttataaa      3360
     acattagttc taattgcatt ctgatgtctg gcaacctact ttcttccccc tgtgatgctg      3420
     cctgcttcta gattttaccc ttctatgaaa tgcagacctc gaggttgcct gggaagcttg      3480
     gtgaaggaat ggtttacctt ccttaacagg atagtagaac atacacagag tatggaaacc      3540
     taaggagatt tcagtgaagt ggagttactc caagtgaaac gctgttttct ggttttagcc      3600
     aaactgcaat tagatgtgtc tttgcaatct aaaagttgta cacaatcaac aatacacttt      3660
     gcttactcct cagcagcaca ttctgaggga gaaacagtca cacccccgca gaaagcctgg      3720
     ttggacttcc gaagacagag gcggtggact gacggatggg tgagagagac aaacacgacc      3780
     taggcatgca tgctgaaggg gaagtgtgtc cattcctact gcatcccatc ttgtgtgctc      3840
     ctgtctggat ttacggcagt gtgtcaaatg taaatctctc aaagccattt aaaaatactc      3900
     actttagtta tggatgaaga agaggagaaa agcagtcctc ctgattgtag tgtttaaacc      3960
     ttaagagttt atcacaaatg ccgatacata cataggacct aaatttatct atgtctgtca      4020
     taccctaaaa tgacattggt ttttggattt ggtatgcatt attattgtta ttattgttat      4080
     tattattctc accaccatga gatcatctat atttatagag gaatagaagt ttatatatat      4140
     aaaatgccat atttttaatt tcgc                                             4164
//


spacer
spacer