Dbfetch

ID   AK142743; SV 1; linear; mRNA; HTC; MUS; 766 BP.
XX
AC   AK142743;
XX
DT   06-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 10)
XX
DE   Mus musculus 16 days neonate heart cDNA, RIKEN full-length enriched
DE   library, clone:D830041G02 product:reticulon 4 receptor-like 2, full insert
DE   sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-766
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (30-MAR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 44986dd55637e453ba4c3a5ecd2c592c.
DR   Ensembl-Gn; ENSMUSG00000050896; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025915; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0025889; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0025859; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025886; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0025645; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0026332; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0025106; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0025626; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0025757; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0025720; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0025845; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0025750; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0026388; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0024850; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0025176; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000054514; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0055677; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0055710; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0055660; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0055642; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0055365; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0056124; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0055574; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0055320; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0055424; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0055385; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0055522; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0055385; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0056276; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0055186; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0054645; mus_musculus_wsbeij.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=D830041G02
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..766
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /dev_stage="16 days neonate"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="D830041G02"
FT                   /tissue_type="heart"
FT                   /db_xref="taxon:10090"
FT   CDS             <1..366
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="putative"
FT                   /note="reticulon 4 receptor-like 2 (MGD|MGI:2669796
FT                   GB|NM_199223, evidence: BLASTN, 100%, match=129)"
FT                   /note="start codon is not identified"
FT                   /db_xref="GOA:Q7M6Z0"
FT                   /db_xref="InterPro:IPR000483"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR003591"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="MGI:MGI:2669796"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7M6Z0"
FT                   /protein_id="BAE25181.1"
FT                   /translation="AAGRADVSRGRVPGARRLAWPRALGRAAHPSALPLAPGAPSPLTA
FT                   VLRRKRPRLGPAPLLCPKEPQLHLRLLFATRPGTFPRPPRSFSSPGPGCLICLLGCCDL
FT                   SMAALKTVCKVVWLRSP"
FT   regulatory      746..751
FT                   /note="putative"
FT                   /regulatory_class="polyA_signal_sequence"
FT   polyA_site      766
FT                   /note="putative"
XX
SQ   Sequence 766 BP; 119 A; 261 C; 194 G; 192 T; 0 other;
     gcagcggggc gagcagacgt gtcccggggc cgcgtgccag gcgcccgcag actcgcgtgg        60
     ccccgcgctc tcggccgggc tgcgcacccc tctgctctgc ctcttgcccc tggcgctcca       120
     tcacctctga ctgcggtgct tagacggaag aggccacgcc ttggccccgc tccccttctc       180
     tgccccaagg agcctcagct ccatcttcgc ctcttgtttg cgacccggcc tggtaccttt       240
     cctaggcctc ctcgctcttt ttcttcccct ggaccaggct gcctcatttg ccttctgggc       300
     tgttgtgact taagtatggc agcccttaag acggtgtgta aggtggtttg gctccgttcg       360
     ccctgattct agccattaac tcttcctccc ccatcccaag gctgggactt ggcaccccgg       420
     gcagccgttg ctcctctctc caagggcccc acagtggact cgaaggggct tttgtctgca       480
     gagcaccttc caccagcaga gcctttgaaa gctcccgctg ggagcctctc ctccttccct       540
     tgatcagagg gatgtctcag caaggcccag gcggcccctg gaccctgctt gtcctgatcc       600
     cttcagcctc ctgcctcctg acacgggagg aatacttttc tcctaagtct acccaggaca       660
     ctttttaggg tgcctggaca gagtttcctc tccaccatgg cccctgtgtg gtgaagatca       720
     aaagaaattg tttgggggaa aatttattaa aaaattctat tatttt                      766
//