Dbfetch

ID   AK142599; SV 1; linear; mRNA; HTC; MUS; 2342 BP.
XX
AC   AK142599;
XX
DT   06-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 11)
XX
DE   Mus musculus 10 days lactation, adult female mammary gland cDNA, RIKEN
DE   full-length enriched library, clone:D730004I19 product:transferrin, full
DE   insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2342
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (30-MAR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 1bdbaee51f9816c53a22ff4ea1f7445f.
DR   Ensembl-Gn; ENSMUSG00000032554; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0035196; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0035176; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0035108; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0035169; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0034879; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0035689; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0034191; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0034848; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0035009; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0034957; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0035085; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0034996; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0035711; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0034311; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000035158; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000112645; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0093929; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0094013; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0093966; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0093939; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0093516; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0094453; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0094114; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0093435; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0093645; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0093499; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0093653; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0093475; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0094780; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0092513; mus_musculus_wsbeij.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=D730004I19
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2342
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /sex="female"
FT                   /dev_stage="10 days lactation, adult"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="D730004I19"
FT                   /tissue_type="mammary gland"
FT                   /db_xref="taxon:10090"
FT   CDS             61..2154
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="putative"
FT                   /note="transferrin (MGD|MGI:98821 GB|AK085754, evidence:
FT                   BLASTN, 100%, match=2159)"
FT                   /db_xref="GOA:Q921I1"
FT                   /db_xref="InterPro:IPR001156"
FT                   /db_xref="InterPro:IPR016357"
FT                   /db_xref="InterPro:IPR018195"
FT                   /db_xref="InterPro:IPR030685"
FT                   /db_xref="MGI:MGI:98821"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q921I1"
FT                   /protein_id="BAE25124.1"
FT                   /translation="MRLTVGALLACAALGLCLAVPDKTVKWCAVSEHENTKCISFRDHM
FT                   KTVLPPDGPRLACVKKTSYPDCIKAISASEADAMTLDGGWVYDAGLTPNNLKPVAAEFY
FT                   GSVEHPQTYYYAVAVVKKGTDFQLNQLEGKKSCHTGLGRSAGWVIPIGLLFCKLSEPRS
FT                   PLEKAVSSFFSGSCVPCADPVAFPKLCQLCPGCGCSSTQPFFGYVGAFKCLKDGGGDVA
FT                   FVKHTTIFEVLPEKADRDQYELLCLDNTRKPVDQYEDCYLARIPSHAVVARKNNGKEDL
FT                   IWEILKVAQEHFGKGKSKDFQLFSSPLGKDLLFKDSAFGLLRVPPRMDYRLYLGHNYVT
FT                   AIRNQQEGVCPEGSIDNSPVKWCALSHLERTKCDEWSIISEGKIECESAETTEDCIEKI
FT                   VNGEADAMTLDGGHAYIAGQCGLVPVMAEYYESSNCAIPSQQGIFPKGYYAVAVVKASD
FT                   TSITWNNLKGKKSCHTGVDRTAGWNIPMGMLYNRINHCKFDEFFSQGCAPGYEKNSTLC
FT                   DLCIGPLKCAPNNKEEYNGYTGAFRCLVEKGDVAFVKHQTVLDNTEGKNPAEWAKNLKQ
FT                   EDFELLCPDGTRKPVKDFASCHLAQAPNHVVVSRKEKAARVKAVLTSQETLFGGSDCTG
FT                   NFCLFKSTTKDLLFRDDTKCFVKLPEGTTPEKYLGAEYMQSVGNMRKCSTSRLLEACTF
FT                   HKH"
FT   regulatory      2324..2329
FT                   /note="putative"
FT                   /regulatory_class="polyA_signal_sequence"
FT   polyA_site      2342
FT                   /note="putative"
XX
SQ   Sequence 2342 BP; 594 A; 589 C; 639 G; 520 T; 0 other;
     ttgggtgcag aagcgggtcg gtctgtactc cccgctcctc gccacacaca caccgagagg        60
     atgaggctca ccgtgggtgc cctgctggcc tgcgctgccc tggggctgtg tctggctgtc       120
     cctgacaaaa cggtcaaatg gtgcgcagtg tcagagcacg agaataccaa gtgcatcagc       180
     ttccgtgacc acatgaagac cgtccttccg cctgatggcc cccggcttgc ctgtgtgaag       240
     aaaacctcct atccggattg catcaaggcc atttctgcaa gtgaagccga tgctatgacc       300
     ttggatgggg gttgggtgta cgatgccggc ctgactccga acaacctgaa gcccgtggcg       360
     gcggagtttt atggatcagt ggaacatcca cagacctact actacgctgt ggctgtggta       420
     aagaagggaa cagacttcca gctgaaccag ctcgaaggca agaagtcctg ccacacaggc       480
     ctgggaaggt ctgcaggctg ggtcatcccc attggcttgc tcttctgtaa gctgtcggag       540
     ccccgcagtc ctcttgagaa agctgtgtcc agtttcttct cgggcagttg tgtcccctgt       600
     gcagatccag tggccttccc caaactgtgt caactgtgcc caggctgtgg ctgctcctcc       660
     actcaaccat tctttggcta cgtaggcgca ttcaagtgtc tgaaagatgg cggtggggat       720
     gtggcctttg tcaagcacac aaccatattt gaggtcttgc cggagaaggc tgacagggac       780
     caatatgaac tgctctgcct tgacaatacc cgcaagccag tggatcagta tgaggattgc       840
     tacctggctc ggatcccttc tcatgctgtt gtggctcgaa aaaacaatgg caaggaagac       900
     ttgatctggg agattctcaa agtggcacag gaacactttg gcaaaggcaa atcaaaagac       960
     ttccaactgt tcagctctcc tcttgggaaa gacctgctgt ttaaagattc tgcctttggg      1020
     ctgttaaggg tccccccaag gatggactac aggctgtacc ttggccataa ctatgtcact      1080
     gccattcgga atcagcagga aggcgtgtgc ccggagggct cgatcgacaa ctcgccagtg      1140
     aagtggtgtg cactgagtca cctggagaga accaagtgtg acgagtggag catcatcagt      1200
     gagggaaaga tagagtgtga gtcagcagag accactgagg actgcattga aaagattgtg      1260
     aacggagaag cggacgccat gactttggat ggaggacatg cctacattgc aggccagtgt      1320
     ggtctagtgc ctgtcatggc agagtactac gagagctcta attgtgccat cccatcacaa      1380
     caaggtatct ttcctaaagg gtattatgcc gtggctgtgg tgaaggcatc ggacactagc      1440
     atcacctgga acaacctgaa aggcaagaag tcctgccaca ctggggtaga cagaaccgct      1500
     ggttggaaca tccctatggg catgctgtac aacaggatca accactgcaa attcgatgaa      1560
     tttttcagtc aaggctgcgc tcccgggtat gagaagaatt ccaccctctg tgacctgtgt      1620
     attggcccac tcaaatgtgc tccgaacaac aaagaggaat ataatggtta cacaggggct      1680
     ttcaggtgtc tcgttgagaa aggagatgta gcctttgtga aacaccagac tgtcctggat      1740
     aacaccgaag gaaagaaccc tgccgaatgg gctaagaatc tgaagcagga agacttcgag      1800
     ttgctctgcc ctgatggcac caggaagcct gtgaaagatt ttgccagctg ccacctggcc      1860
     caagctccaa accatgttgt ggtctcacga aaagagaagg cagcccgggt taaggctgta      1920
     ctgactagcc aggagacttt atttggggga agtgactgca ccggcaattt ctgtttgttc      1980
     aagtccacca ccaaggacct tctgttcagg gatgacacca aatgtttcgt taaacttcca      2040
     gagggtacca cacctgaaaa atacttagga gcggagtaca tgcaatctgt cggtaacatg      2100
     aggaagtgct caacctcacg actcctggaa gcctgcactt tccacaaaca ttaaaatcca      2160
     agaggcggtg gtggtgcatg cctttaatcc cagcactcgg gaggcagagg caggtggatt      2220
     tctgagttcg aggccagcct ggtctacgga gtgagttcca gggcagccag ggctacacag      2280
     agaaaccctg tctcaaaaaa acaaacaaac aaaaaagctc ccaattaaat gctttcttct      2340
     gt                                                                     2342
//