spacer

EBI Dbfetch

ID   AK142068; SV 1; linear; mRNA; HTC; MUS; 1762 BP.
XX
AC   AK142068;
XX
DT   06-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 11)
XX
DE   Mus musculus 12 days embryo eyeball cDNA, RIKEN full-length enriched
DE   library, clone:D230020F23 product:Nav1.7 (Fragment) homolog [Homo sapiens],
DE   full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1762
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (30-MAR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 14ec8f1b5feff65bc3cb9773ef0b0634.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=D230020F23
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1762
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /dev_stage="12 days embryo"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="D230020F23"
FT                   /tissue_type="eyeball"
FT                   /db_xref="taxon:10090"
FT   CDS             328..>1762
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="Nav1.7 (Fragment) homolog [Homo sapiens]
FT                   (UniProt|Q8WTU1, evidence: FASTY, 99.1%ID, 100%length,
FT                   match=345)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q3UQV9"
FT                   /db_xref="InterPro:IPR005821"
FT                   /db_xref="InterPro:IPR027359"
FT                   /db_xref="InterPro:IPR028803"
FT                   /db_xref="MGI:MGI:107636"
FT                   /db_xref="UniProtKB/TrEMBL:Q3UQV9"
FT                   /protein_id="BAE24929.1"
FT                   /translation="MAMLPPPGPQSFVHFTKQSLALIEQRISEEKAKGHKDEKKDDEEE
FT                   GPKPSSDLEAGKQLPFIYGDIPPGMVSEPLEDLDPYYADKKTFIVLNKGKAIFRFNATP
FT                   ALYMLSPFSPLRRISIKILVHSLFSMLIMCTILTNCIFMTMSNPPDWTKNVEYTFTGIY
FT                   TFESLIKILARGFCVGEFTFLRDPWNWLDFVVIVFAYLTEFVNLGNVSALRTFRVLRAL
FT                   KTISVIPGLKTIVGALIQSVKKLSDVMILTVFCLSVFALIGLQLFMGNLKHKCFRKDLE
FT                   QNETLESIMSTAESEEELKRYFYYLEGSKDALLCGFSTDSGQCPEGYECVTAGRNPDYG
FT                   YTSFDTFGWAFLALFRLMTQDYWENLYQQTLRAAGKTYMIFFVVVIFLGSFYLINLILA
FT                   VVAMAYEEQNQANIEEAKQKELEFQQMLDRLKKEQEEAEAIAAAAAEYTSLGRSRIMGL
FT                   SESSSETSRLSSKSAKERRN"
XX
SQ   Sequence 1762 BP; 501 A; 400 C; 431 G; 430 T; 0 other;
     tgggggtcgc ttcatcctga gcagactaga aacagacaga ctccgtgcag gcctagcctg        60
     cgctccaatt gcgactctag ccttttcaat cctgcccact gtgcaggctg gtctggtcta       120
     gcctgggtat cccggactcc tagtagcagg cactgtgagc aacaggattt caaagaaaga       180
     agcagaggga agaaagaagc ctgggaagag aggaagactt cccttggatc agaatccgca       240
     ggtgcactca ccgggtgggc atgatccgtg gggccaggcc tcttaggtaa ggatccgaag       300
     gggaaataaa acctacagga tgagaagatg gcgatgttgc ctccgccagg acctcagagc       360
     ttcgttcact tcacaaaaca gtcccttgcc ctcattgaac aacgcatttc tgaagaaaaa       420
     gccaagggac acaaagatga aaagaaagat gatgaggaag aaggtcccaa gcccagtagt       480
     gacttggaag caggtaaaca gctacccttc atctacggag acattccccc gggaatggtg       540
     tcagagcccc tggaggacct ggacccatac tatgcagaca aaaaaacttt tatagtattg       600
     aacaaaggga aagcaatctt ccgtttcaac gccacccctg ctttgtacat gctgtctccc       660
     ttcagtcctc tcagaagaat atctattaag attttagtgc actccttatt cagcatgcta       720
     atcatgtgca caattctgac aaactgcata ttcatgacca tgagcaaccc tccagattgg       780
     accaaaaacg tagagtacac ttttactggg atatatactt ttgaatcact cataaaaatc       840
     cttgcaagag gcttttgcgt gggcgaattc accttcctcc gtgacccttg gaactggctg       900
     gactttgttg tcattgtttt tgcgtattta acagaatttg taaacctagg caatgtttca       960
     gctcttcgaa ctttcagagt cttgagagct ttgaaaacta tttctgtaat tccaggacta      1020
     aaaaccatcg tgggggccct gatccaatca gtgaagaagc tctctgacgt catgatcctc      1080
     actgtgttct gtctcagtgt gttcgcacta attggactac aactgtttat gggcaacttg      1140
     aagcataaat gtttccggaa ggaccttgag cagaatgaaa cattagaaag catcatgagt      1200
     actgctgaga gtgaagaaga attgaaaaga tatttttatt acttggaggg atccaaagat      1260
     gctcttcttt gcggtttcag cacagattca gggcagtgtc ctgaagggta cgagtgtgtg      1320
     acagctggca gaaacccaga ttatggctac acaagctttg acacgttcgg ctgggccttc      1380
     ttggccttgt ttcggctaat gactcaggac tactgggaga acctttatca acagacactg      1440
     cgtgctgctg gcaaaaccta catgattttc tttgtcgtgg tgatatttct gggatccttt      1500
     tacctgataa acttgatcct ggctgtggta gccatggcgt acgaggaaca gaaccaggcc      1560
     aacatcgaag aagctaaaca gaaagagtta gaatttcagc agatgttaga ccgactcaaa      1620
     aaagagcagg aagaagccga ggcgatcgct gcagccgctg ctgagtacac gagtttaggg      1680
     cggagcagga ttatgggact ctctgagagc tcttcagaaa cctccaggct gagctcaaag      1740
     agtgccaagg agagaagaaa cc                                               1762
//


spacer
spacer