spacer

EBI Dbfetch

ID   AK141625; SV 1; linear; mRNA; HTC; MUS; 4667 BP.
XX
AC   AK141625;
XX
DT   06-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 11)
XX
DE   Mus musculus adult male hippocampus cDNA, RIKEN full-length enriched
DE   library, clone:C630046L14 product:5 hydroxytryptamine (serotonin) receptor
DE   4, full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-4667
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (30-MAR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 889b34d147a421ee7295dd10ce0c147d.
DR   Ensembl-Gn; ENSMUSG00000026322; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000027560; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=C630046L14
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4667
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /sex="male"
FT                   /dev_stage="adult"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="C630046L14"
FT                   /tissue_type="hippocampus"
FT                   /db_xref="taxon:10090"
FT   CDS             214..1380
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="5 hydroxytryptamine (serotonin) receptor 4
FT                   (MGD|MGI:109246 GB|NM_008313, evidence: BLASTN, 99%,
FT                   match=1287)"
FT                   /note="putative"
FT                   /db_xref="GOA:P97288"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR001520"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:109246"
FT                   /db_xref="UniProtKB/Swiss-Prot:P97288"
FT                   /protein_id="BAE24773.1"
FT                   /translation="MDKLDANVSSNEGFRSVEKVVLLTFLAVVILMAILGNLLVMVAVC
FT                   RDRQLRKIKTNYFIVSLAFADLLVSVLVMPFGAIELVQDIWAYGEMFCLVRTSLDVLLT
FT                   TASIFHLCCISLDRYYAICCQPLVYRNKMTPLRIALMLGGCWVLPMFISFLPIMQGWNN
FT                   IGIVDVIEKRKFSHNSNSTWCVFMVNKPYAITCSVVAFYIPFLLMVLAYYRIYVTAKEH
FT                   AQQIQMLQRAGATSESRPQPADQHSTHRMRTETKAAKTLCVIMGCFCFCWAPFFVTNIV
FT                   DPFIDYTVPEQVWTAFLWLGYINSGLNPFLYAFLNKSFRRAFLIILCCDDERYKRPPIL
FT                   GQTVPCSTTTINGSTHVLRDTVECGGQWESRCHLTATSPLVAAQPSDT"
XX
SQ   Sequence 4667 BP; 1171 A; 1061 C; 1040 G; 1395 T; 0 other;
     gagtggcggg gtgcgctact cagcgcagca gcagcggcag aagcagggtt ctgcgctaaa        60
     ggtggccgca gcaatctgct agggtgccgc tctccctagc cttccgcagc cgcgtggtgc       120
     tgggagtgtg ccaggagatc agaaccccag gagcccacgt gtgcagggtc ctgtgggcac       180
     tgaaatccaa cgtcctcatg cccatttcct gtaatggaca aacttgatgc taatgtgagt       240
     tccaacgagg gtttcaggtc cgtggagaag gtcgtgctgc tcacgttcct tgcagtggtt       300
     atcctgatgg ccatcttggg caacctgctg gtgatggtgg ctgtgtgcag ggacaggcag       360
     ctcaggaaaa taaaaaccaa ctatttcatt gtgtctctcg cctttgctga cctgctggtt       420
     tcggtgctgg tgatgccctt tggtgccatt gagctggtcc aagacatctg ggcttatggg       480
     gagatgttct gcctggtccg gacctctctg gatgtcctac ttaccacagc atcgatcttt       540
     cacctgtgct gtatttccct ggacaggtat tacgccatct gctgccagcc tttggtttat       600
     aggaacaaga tgacccctct acgcatcgca ttaatgttgg gaggctgctg ggtccttccc       660
     atgtttatat cttttctccc cataatgcaa ggctggaaca acatcggcat agttgatgtg       720
     atagagaaaa ggaaattcag ccacaactct aactccacgt ggtgtgtctt catggtcaac       780
     aagccctatg ctatcacctg ctctgtggtg gccttctaca tcccgtttct cctcatggtg       840
     ctggcctatt accgaatcta tgtcactgct aaggagcatg cccagcagat acagatgtta       900
     caacgggcag gagccacctc tgaaagcagg ccccagccag ctgaccagca cagcacacat       960
     cgcatgagga cagagaccaa ggcagccaag actttatgtg tcatcatggg ctgcttctgt      1020
     ttctgctggg cccccttctt tgtcaccaat attgtggacc ctttcataga ctacactgtc      1080
     cccgagcagg tgtggactgc tttcctctgg cttggctata tcaattcggg gttgaaccct      1140
     tttctctatg ccttcttgaa taagtctttc agacgtgcct tcctcatcat cctctgctgt      1200
     gatgatgagc gctacaaaag accccccatt ctgggccaga ctgtcccctg ttcaaccaca      1260
     accattaatg gatccaccca tgtactaagg gatacagtgg aatgtggtgg ccagtgggag      1320
     agtcggtgtc acctcacagc aacttctcct ttggtggctg ctcagcccag tgatacttaa      1380
     gcccctggga caatgaccta gaagacagct gtggcttgaa acgaagccag tcctaagctg      1440
     ctacttgtgt gtatgtggct ggccctggca ctctcttctc caaggctttc caagagcatg      1500
     aggcaatccg cactggactt tcccgccagg aatccagcag gcggtatttg aggaagtcag      1560
     gggagagaag ggcttcctcc ttcccttcgc tttctgtttc tcaagagttc ttcttcctgg      1620
     agtctccact cttgcttggt ggtctctgaa gtctatgacc tagtctcctt gctgttttca      1680
     gtctgtcctg taaacgttta ctgtgttcaa ttttctgttt ccaaacatgc cttctttgaa      1740
     gtgtcatctt acagatactg tcaaaacatg tgcatgtctt tatcacattt cttgcttggt      1800
     cacatctacc atagctgtgt tcagacactc caccatcttt cctttgctct cttctctgct      1860
     gggcccttgt tcactttctt tcctttgtct gggtatagac atgtatcctc ttggccaacc      1920
     ctgtgtcagc cacagaactc tgttttcttt ttcctgtgtt tagtggtacc attctcttca      1980
     ggacaggctc catccatttg cagtcggaga cacagaagag agatccgtca gtgggaaacg      2040
     gtctctgcag aaaccctgga aggaagtcag gaccagatct atctcatctg agagatttca      2100
     ctttcctttc agcttagcac acctaaagag ccttaggcag ggctggttca tcacatgcat      2160
     ctattaagag atgctcagac tcttctatga gcttgtggtg aaacacacag tagcagctca      2220
     aaacctcaga gtatggcttt gctgcttcca gtggacctta ctgatggatg ctcaccttgt      2280
     ggagccttgt cactcttgct atcttctagg tggagaagtc cagaaatgct agtaatgaga      2340
     aaacagaatc tggctccaag tcagaggacc caaatgtaag cccaggccct gcttctgaaa      2400
     cgctgtgaga ccatgaacaa tgtctttcca tctatgaatt tcactctcta cattgccaaa      2460
     tttaacttgg agcagaggag tctttaagat ttctttccat ttctaagaca ataggatgct      2520
     gctatagcct gccatctgct acctcaaaag ctcatggcct gcctacctgt tggctttgtt      2580
     tcaaaggaat ggccctcctg atttgggcat gctagacttc tgacttgatc atctgtgcaa      2640
     actggtgaaa cacagtgaac ctggtgtctt tcactcaaag ccgagtccat agtttgtctc      2700
     aactacccga gagcaaaggc tctggtgatg gaagcaccac ttctcagagc caggtgaggt      2760
     tcagctttcg ccttgactgt ggtttgattc cacctcagga ctatgcactg caccgttctc      2820
     ttgagcttct cgtggaatgg cacttgctat tcctgtcagc attgactttc attctggaac      2880
     tgaacttggc aggaaataga ctttggaatg aggaagagaa gattgccaaa accagtcaaa      2940
     tgccaaaaaa gaattctctg ttatgtgaag acttaaattt tcttgagcac gagtcttagc      3000
     aaaaggaagt agaccctgag agagaactcc tatatgctgc tggggaaaga aaaaaaaaaa      3060
     gctctgtgct aagaaatatt gatgctgaga tggttcgtgt caaaactgat ccaatggagc      3120
     agttctcact ggaggcctct tctcgtcaac catgaagaga gttgaagcat caccttgcat      3180
     actgacgttg tagcgggatc agtccacttt gatttttaac tccttgcttc cttgccgtgg      3240
     ctaagctcag cactcatttg gaggcaagca gtgttttgaa gctggttctt tttaatacaa      3300
     gagatgagat gcaaccaact tgcctcgact gaccatatgc ccaccccgtc aacgaacatg      3360
     gtggtgggtg agtggctcag gcactgagtc aatgatggac tggctgagtg gatggaattg      3420
     aaagctggat ggtgtgagcc tcaggaacac ttctgagtac tctgaaacag ttgatgtgga      3480
     gagaaattat gtttatggag acattttgta aaatataaag gggcagctca tatgtttgtt      3540
     attattatgg gtattttgaa ttactgtgct ctcaagacca cttttttttt tttcactaaa      3600
     aaatgagggt cagtttagag tgaggtttct gtgttggaaa caaaacccag agcaaccctt      3660
     gggtaccaac atgcccctgg gtactcattc cttattaatt gcttctcatt ggttgcttag      3720
     cccacacatt tatacatcac ccttcattta aagggatttc tttgttctca aaggggtgaa      3780
     tagagaagga gaccgtgggc aagttttggt aagaatggct ctaattttat atgtaactcc      3840
     atagttccat aagctaagtt catatacctg ctttttatat aaaaatgtat ctgaaaaaaa      3900
     ttccctatac actaacacta acttcccacc cttacaaata aaatatatac cataactata      3960
     tatttattca atatatatac atatacacta tatatgtaca tatataatat atattatatt      4020
     aaatgtggac caatgtatga atggccagct gacaagaatg ttacataatg ggtcactaag      4080
     ttactgaaca aggatagact ttgatatttc ctgacctgat gataagccac tgttgactac      4140
     agcataatgt cgttttatct aatactttta ttttgtttac agtttgtcca tgtgtagtta      4200
     ccagtggggc cacttgtatt atttgtagtt caatgaagcc tctagtataa tcaatccagt      4260
     aagtacatgt gtgcctgctg ttgagaacat gaagcataaa tcttacgagt ttaggggttg      4320
     gggagttcca actatggtgt catgaactgg ttggctatac ctgtggttta ttgacgctaa      4380
     tatttttaag gtaccaagag ccctgattat taccttgttt ccatggaaag catccttggt      4440
     tttatgacag atccttttga tgcagtttcc aggaatatgt tcttggaaaa cacagggacc      4500
     ttcacaggtt ttgtttttaa actgattaat tatatttatt gataaaatat tgttatatta      4560
     cacatgtttg tatgacttca tctgtacatg tttaaataag ttatacatta tgacaaatct      4620
     taaatcataa aagaaataat tgagttttga gtatgcaata aaatgcc                    4667
//


spacer
spacer