spacer

EBI Dbfetch

ID   AK141587; SV 1; linear; mRNA; HTC; MUS; 4606 BP.
XX
AC   AK141587;
XX
DT   06-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 11)
XX
DE   Mus musculus adult male hippocampus cDNA, RIKEN full-length enriched
DE   library, clone:C630036D03 product:5 hydroxytryptamine (serotonin) receptor
DE   4, full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-4606
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (30-MAR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 5a6c895fc73cf543d839dde877f88e25.
DR   Ensembl-Gn; ENSMUSG00000026322; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000027560; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=C630036D03
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4606
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /sex="male"
FT                   /dev_stage="adult"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="C630036D03"
FT                   /tissue_type="hippocampus"
FT                   /db_xref="taxon:10090"
FT   CDS             157..1323
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="5 hydroxytryptamine (serotonin) receptor 4
FT                   (MGD|MGI:109246 GB|NM_008313, evidence: BLASTN, 99%,
FT                   match=1287)"
FT                   /note="putative"
FT                   /db_xref="GOA:P97288"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR001520"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:109246"
FT                   /db_xref="UniProtKB/Swiss-Prot:P97288"
FT                   /protein_id="BAE24750.1"
FT                   /translation="MDKLDANVSSNEGFRSVEKVVLLTFLAVVILMAILGNLLVMVAVC
FT                   RDRQLRKIKTNYFIVSLAFADLLVSVLVMPFGAIELVQDIWAYGEMFCLVRTSLDVLLT
FT                   TASIFHLCCISLDRYYAICCQPLVYRNKMTPLRIALMLGGCWVLPMFISFLPIMQGWNN
FT                   IGIVDVIEKRKFSHNSNSTWCVFMVNKPYAITCSVVAFYIPFLLMVLAYYRIYVTAKEH
FT                   AQQIQMLQRAGATSESRPQPADQHSTHRMRTETKAAKTLCVIMGCFCFCWAPFFVTNIV
FT                   DPFIDYTVPEQVWTAFLWLGYINSGLNPFLYAFLNKSFRRAFLIILCCDDERYKRPPIL
FT                   GQTVPCSTTTINGSTHVLRDTVECGGQWESRCHLTATSPLVAAQPSDT"
FT   polyA_signal    4592..4597
FT                   /note="putative"
FT   polyA_site      4606
FT                   /note="putative"
XX
SQ   Sequence 4606 BP; 1154 A; 1037 C; 1026 G; 1389 T; 0 other;
     taaggtggcc gcagcaatct gctagggtgc cgctctccct agccttccgc agccgcgtgg        60
     tgctgggagt gtgccaggag atcagaaccc caggagccca cgtgtgcagg gtcctgtggg       120
     cactgaaatc caacgtcctc atgcccattt cctgtaatgg acaaacttga tgctaatgtg       180
     agttccaacg agggtttcag gtccgtggag aaggtcgtgc tgctcacgtt ccttgcagtg       240
     gttatcctga tggccatctt gggcaacctg ctggtgatgg tggctgtgtg cagggacagg       300
     cagctcagga aaataaaaac caactatttc attgtgtctc tcgcctttgc tgacctgctg       360
     gtttcggtgc tggtgatgcc ctttggtgcc attgagctgg tccaagacat ctgggcttat       420
     ggggagatgt tctgcctggt ccggacctct ctggatgtcc tacttaccac agcatcgatc       480
     tttcacctgt gctgtatttc cctggacagg tattacgcca tctgctgcca gcctttggtt       540
     tataggaaca agatgacccc tctacgcatc gcattaatgt tgggaggctg ctgggtcctt       600
     cccatgttta tatcttttct ccccataatg caaggctgga acaacatcgg catagttgat       660
     gtgatagaga aaaggaaatt cagccacaac tctaactcca cgtggtgtgt cttcatggtc       720
     aacaagccct atgctatcac ctgctctgtg gtggccttct acatcccgtt tctcctcatg       780
     gtgctggcct attaccgaat ctatgtcact gctaaggagc atgcccagca gatacagatg       840
     ttacaacggg caggagccac ctctgaaagc aggccccagc cagctgacca gcacagcaca       900
     catcgcatga ggacagagac caaggcagcc aagactttat gtgtcatcat gggctgcttc       960
     tgtttctgct gggccccctt ctttgtcacc aatattgtgg accctttcat agactacact      1020
     gtccccgagc aggtgtggac tgctttcctc tggcttggct atatcaattc ggggttgaac      1080
     ccttttctct atgccttctt gaataagtct ttcagacgtg ccttcctcat catcctctgc      1140
     tgtgatgatg agcgctacaa aagacccccc attctgggcc agactgtccc ctgttcaacc      1200
     acaaccatta atggatccac ccatgtacta agggatacag tggaatgtgg tggccagtgg      1260
     gagagtcggt gtcacctcac agcaacttct cctttggtgg ctgctcagcc cagtgatact      1320
     taagcccctg ggacaatgac ctagaagaca gctgtggctt gaaacgaagc cagtcctaag      1380
     ctgctacttg tgtgtatgtg gctggccctg gcactctctt ctccaaggct ttccaagagc      1440
     atgaggcaat ccgcactgga ctttcccgcc aggaatccag caggcggtat ttgaggaagt      1500
     caggggagag gagggcttcc tccttccctt cgctttctgt ttctcaagag ttcttcttcc      1560
     tggagtctcc actcttgctt ggtggtctct gaagtctatg acctagtctc cttgctgttt      1620
     tcagtctgtc ctgtaaacgt ttactgtgtt caattttctg tttccaaaca tgccttcttt      1680
     gaagtgtcat cttacagata ctgtcaaaac atgtgcatgt ctttatcaca tttcttgctt      1740
     ggtcacatct accatagctg tgttcagaca ctccaccatc tttcctttgc tctcttctct      1800
     gctgggccct tgttcacttt ctttcctttg tctgggtata gacatgtatc ctcttggcca      1860
     accctgtgtc agccacagaa ctctgttttc tttttcctgt gtttagtggt accattctct      1920
     tcaggacagg ctccatccat ttgcagtcgg agacacagaa gagagatccg tcagtgggaa      1980
     acggtctctg cagaaaccct ggaaggaagt caggaccaga tctatctcat ctgagagatt      2040
     tcactttcct ttcagcttag cacacctaaa gagccttagg cagggctggt tcatcacatg      2100
     catctattaa gagatgctca gactcttcta tgagcttgtg gtgaaacaca cagtagcagc      2160
     tcaaaacctc agagtatggc tttgctgctt ccagtggacc ttactgatgg atgctcacct      2220
     tgtggagcct tgtcactctt gctatcttct aggtggagaa gtccagaaat gctagtaatg      2280
     agaaaacaga atctggctcc aagtcagagg acccaaatgt aagcccaggc cctgcttctg      2340
     aaacgctgtg agaccatgaa caatgtcttt ccatctatga atttcactct ctacattgcc      2400
     aaatttaact tggagcagag gagtctttaa gatttctttc catttctaag acaataggat      2460
     gctgctatag cctgccatct gctacctcaa aagctcatgg cctgcctacc tgttggcttt      2520
     gtttcaaagg aatggccctc ctgatttggg catgctagac ttctgacttg atcatctgtg      2580
     caaactggtg aaacacagtg aacctggtgt ctttcactca aagccgagtc catagtttgt      2640
     ctcaactacc cgagagcaaa ggctctggtg atggaagcac cacttctcag agccaggtga      2700
     ggttcagctt tcgccttgac tgtggtttga ttccacctca ggactatgca ctgcaccgtt      2760
     ctcttgagct tctcgtggaa tggcacttgc tattcctgtc agcattgact ttcattctgg      2820
     aactgaactt ggcaggaaat agactttgga atgaggaaga gaagattgcc aaaaccagtc      2880
     aaatgccaaa aaagaattct ctgttatgtg aagacttaaa ttttcttgag cacgagtctt      2940
     agcaaaagga agtagaccct gagagagaac tcctatatgc tgctggggaa agaaaaaaaa      3000
     aagctctgtg ctaagaaata ttgatgctga gatggttcgt gtcaaaactg atccaatgga      3060
     gcagttctca ctggaggcct cttctcgtca accatgaaga gagttgaagc atcaccttgc      3120
     atactgacgt tgtagcggga tcagtccact ttgattttta actccttgct tccttgccgt      3180
     ggctaagctc agcactcatt tggaggcaag cagtgttttg aagctggttc tttttaatac      3240
     aagagatgag atgcaaccaa cttgcctcga ctgaccatat gcccaccccg tcaacgaaca      3300
     tggtggtggg tgagtggctc aggcactgag tcaatgatgg actggctgag tggatggaat      3360
     tgaaagctgg atggtgtgag cctcaggaac acttctgagt actctgaaac agttgatgtg      3420
     gagagaaatt atgtttatgg agacattttg taaaatataa aggggcagct catatgtttg      3480
     ttattattat gggtattttg aattactgtg ctctcaagac cacttttttt tttcactaaa      3540
     aaatgaggtc agtttagagt gaggtttctg tgttggaaac aaaacccaga gcaacccttg      3600
     ggtaccaaca tgcccctggg tactcattcc ttattaattg cttctcattg gttgcttagc      3660
     ccacacattt atacatcacc cttcatttaa agggatttct ttgttctcaa aggggtgaat      3720
     agagaaggag accgtgggca agttttggta agaatggctc taattttata tgtaacttca      3780
     tagtttcata agctaagttc atatacctgc tttttatatg aaaatgtatc tgagggaaat      3840
     tccctataca tgagagctaa ttcccacctt acaaatgaaa tatatacatg atatatattt      3900
     atttaatata tatacatata cactatatat gtacatatat aatatatatt atattaaatg      3960
     tggaccaatg tatgaatggc cagctgacaa gaatgttaca taatgggtca ctaagttact      4020
     gaacaaggat agactttgat atttcctgac ctgatgataa gccactgttg actacagcat      4080
     aatgtcgttt tatctaatac ttttattttg tttacagttt gtccatgtgt agttaccagt      4140
     ggggccactt gtattatttg tagttcaatg aagcctctag tataatcaat ccagtaagta      4200
     catgtgtgcc tgctgttgag aacatgaagc ataaatctta cgagtttagg ggttggggag      4260
     ttccaactat ggtgtcatga actggttggc tatacctgtg gtttattgac gctaatattt      4320
     ttaaggtacc aagagccctg attattacct tgtttccatg gaaagcatcc ttggttttat      4380
     gacagatcct tttgatgcag tttccaggaa tatgttcttg gaaaacacag ggaccttcac      4440
     aggttttgtt tttaaactga ttaattatat ttattgataa aatattgtta tattacacat      4500
     gtttgtatga cttcatctgt acatgtttaa ataagttata cattatgaca aatcttaaat      4560
     cataaaagaa ataattgagt tttgagtatg caataaaatg ccaaag                     4606
//


spacer
spacer