spacer

EBI Dbfetch

ID   AK141541; SV 1; linear; mRNA; HTC; MUS; 3329 BP.
XX
AC   AK141541;
XX
DT   06-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 10)
XX
DE   Mus musculus adult male hippocampus cDNA, RIKEN full-length enriched
DE   library, clone:C630015N05 product:guanine nucleotide binding protein (G
DE   protein), gamma 7 subunit, full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-3329
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (30-MAR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; b082d5abf183f8524faf9547e7025340.
DR   Ensembl-Gn; ENSMUSG00000048240; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000092285; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000099462; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000117805; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000118233; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000118465; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=C630015N05
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3329
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /sex="male"
FT                   /dev_stage="adult"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="C630015N05"
FT                   /tissue_type="hippocampus"
FT                   /db_xref="taxon:10090"
FT   CDS             131..337
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="guanine nucleotide binding protein (G protein),
FT                   gamma 7 subunit (MGD|MGI:95787 GB|NM_010319, evidence:
FT                   BLASTN, 99%, match=3284)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q3UGN1"
FT                   /db_xref="InterPro:IPR001770"
FT                   /db_xref="InterPro:IPR015898"
FT                   /db_xref="MGI:MGI:95787"
FT                   /db_xref="UniProtKB/TrEMBL:Q3UGN1"
FT                   /protein_id="BAE24725.1"
FT                   /translation="MSGTNNVAQARKLVEQLRIEAGIERIKVSKASSDLMGYCEQHARN
FT                   DPLLVGVPASENPFKDKKPCIIL"
FT   polyA_signal    3311..3316
FT                   /note="putative"
FT   polyA_site      3329
FT                   /note="putative"
XX
SQ   Sequence 3329 BP; 753 A; 959 C; 849 G; 768 T; 0 other;
     ggcgttcggc tgtgcggctg ctgagacact ggctggaggc agggtgtgaa gcctttctat        60
     tggaacctca gtgctgggac ggtgggacgg tgcagctctc tagacgccag gtccacgctc       120
     atggccgatg atgtcaggta ctaacaacgt cgcccaggcc cggaagctgg tggagcagct       180
     gcgcattgaa gctgggatcg aacgcatcaa ggtctccaag gcctcgtcag acctgatggg       240
     ctactgtgag caacatgccc gcaacgatcc cttgctggtt ggcgtgccag cctctgagaa       300
     tccattcaaa gacaaaaagc cttgcataat tctctagttc tctctctttc tctctctctt       360
     ccccatctct ccctctcttt ctccccaccc cggaggtatt ggtccaattt ttcctgtaag       420
     gaaaatattt gaatccttcc cactttgaat tctaaaggaa caaaaaccat tgtgaatgcc       480
     gggatcttcc tgacctagct ggagtttatg aacccaggtg gggctctgac tgtcgcctgg       540
     cctaactgag atgttagcct cgtcaccccc accccctctt ttcaagagtc actactgtgg       600
     cccattttta aagctcccct tagttgcctt ggggaaaggg ctccgttgat aaacgggatt       660
     gccttgcaag cgtgaggacc ctaggtgcgg cgcggtcctc aggtcccaca gaaagcatgc       720
     aggtgcagtg tcacaaggtt gtatgtactt cagcacttgg taggcaaggc agaagggtcc       780
     ccagggcttg agggactgcc attctagttg tcagtaaact ccagacagag gaggacaccc       840
     agccttgacc tctggctcca cccgcgcggg gcacacacaa tgcaccctgt gctgccctgt       900
     gtccttccag agtggccctg tcatgtacac agtgacgcca tttctccaga gacatggccc       960
     attccagaga cgggcatctg ggtctccatt caaaggaagc tcttgctggt atgaccgagt      1020
     gtgtaatttt gtctcctaag cctgagatcc acgtggtcat tggtggctcc ccattttctc      1080
     ccagttacac agttatccag gtagttgtga gggcagaaat gcagattagt tatctctcga      1140
     ggtgatcgag gagtgacggg gttctccgtc ccacatcgtg actgtggctc cagatccccc      1200
     tgcctccttc ctaggacaaa ctattttgta actagctaga atccaagccc ctcagtgtgg      1260
     ggactgtagc cctggtctgc actcccagat tgggggattc taggcagggc tccacccaga      1320
     ccacacccca atgaggattt ggggactcta ggcggggctc caccccgaac tgcgacctca      1380
     gccccttact ggggcattct aggtggggct ctacattgac cactccccca gcccctcact      1440
     gggagattgt agtctggggc tccaccctga ccacgcccct agacccttgt tggtagattc      1500
     tccacagcat tctacccctg agccaggcct cttctctttc tattttgtga acagagccct      1560
     agagtccagg ctggcctgga acaggagatc ttcctgcctc tgtctccaga gtacctacat      1620
     gacggtcttg tgcttgcatg cctggcattg gattggactg aagaaaacat gccctctgtc      1680
     tgtaacagtg acagtggcag gtatagggag gacacgactt gggtgtgcca atgcggtgtg      1740
     cagccacaca cagaggcagc ctaagcattt gaaagacccc agctgcctct ttctcctgcc      1800
     agatcagtat gggagcaaac cgcagaactg aagccagtct agttgttccc tgtatccctg      1860
     gtggaaatct gctgccaaaa gcctgggcca ggctgatccc tgggcaaagt gaaaggggtg      1920
     agcacagtta gctcatcttc tagccagtta ggcatgacct accgcctagg taaggtggca      1980
     ggctccccca aatccatttg atggaaacag gaaaagaagt ctggggtgtg actaagggga      2040
     ggcattgcag gtgctaagag cgcccccctc ccacttcccc ctccatgggc tgggtcccag      2100
     agagcacaga ccaagggtct ggcttctgtg catcagctcc cattactggt cagagagggc      2160
     cagcaacttt ggtcagcctg actctcagaa cctggcttga gtcagaaaag ccagtttccc      2220
     ccaccctcaa actacagcca ccttgcatta ggctaggaac caggtcccag gatgtgtgtc      2280
     cccagctaca ctggcaagga gaaaggaaag ctggaaatct ggggaccagg gctgcagagc      2340
     acccacccag catgctggaa agctgggttc caccccaagc tcgaagtaac caggcacggg      2400
     cactggggta ggcagatcag gacttcaggg tcttcctcag ctacataatg ggctcaaggc      2460
     taacctggac tacatgagac catgtctcaa attcagtgca ctctctcact ctctcacatc      2520
     acgacagcag atgcctgcct ggccagcctg tgtgtggtcg gagcattttg tttctctcct      2580
     ctgggacaaa aaactcaaat ctgcatctct gcccacactt ccagttctcc ctccctaggt      2640
     gactcacagg ccaaggacaa agtgacttct tgttcccaag gaaggtagga cgtgcttggc      2700
     tgatgtatcc aggatggacc ttgggcccca atagcacttg tgtgccctcc taaccactgg      2760
     agccctgcct cagcttagag atacttaggg aaaccagaac acaacagagc catcaggagc      2820
     caagattggg ggccctcacc ttcaatccca acacttggga gacagaggca aggggatctc      2880
     cgtgaattcg aggccagcct catctacaga gtgagttcca ggacagccag ggttgtagag      2940
     acaccgtcta aaaacaaaat aaaacaacca aaactgttag acctgctgca gcttgagcca      3000
     cccaggaggg acttccaacc taaggagaag gttggtgggc atgggggggt gtatcctaca      3060
     cagaagccat atacactggc cagatgtcac atggcacttt ccatttccgt ccccacttca      3120
     gggctggctc ctccccctca cgctccaggg ctggctccta ccccttcaga ctcctccccc      3180
     ttccctctgc tttgtgaagc tggttggttt ttatttctga ttaaaaaaaa aactttttcc      3240
     cgtgtgccac gcccactctc ccagtgttac tattgtgtgg aatgaggtca caggagagtg      3300
     actcctccat aataaaagcc tcgattttc                                        3329
//


spacer
spacer