Dbfetch

ID   AK141239; SV 1; linear; mRNA; HTC; MUS; 1795 BP.
XX
AC   AK141239;
XX
DT   06-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 11)
XX
DE   Mus musculus ES cells cDNA, RIKEN full-length enriched library,
DE   clone:C330034L04 product:nuclear receptor subfamily 0, group B, member 1,
DE   full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1795
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (30-MAR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; e0b2499271e25c2df2dd921989bc41a2.
DR   Ensembl-Gn; ENSMUSG00000025056; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000026036; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=C330034L04
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1795
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="C330034L04"
FT                   /cell_type="ES cells"
FT                   /db_xref="taxon:10090"
FT   CDS             28..1446
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="nuclear receptor subfamily 0, group B, member 1
FT                   (MGD|MGI:1352460 GB|NM_007430, evidence: BLASTN, 99%,
FT                   match=1781)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q53ZY9"
FT                   /db_xref="InterPro:IPR000536"
FT                   /db_xref="InterPro:IPR001723"
FT                   /db_xref="InterPro:IPR025900"
FT                   /db_xref="MGI:MGI:1352460"
FT                   /db_xref="UniProtKB/TrEMBL:Q53ZY9"
FT                   /protein_id="BAE24608.1"
FT                   /translation="MAGEDHPWQGSILYNLLMSAKQKHASQEEREVRLGAQCWGCACGA
FT                   QPVLGGERLSGGQARSLLYRCCFCGENHPRQGGILYSMLTNARQPSVATQAPRARFGAP
FT                   CWGCACGSAEPLVGREGLPAGQAPSLLYRCCFCGEEHPRQGSILYSLLTSAQQTHVSRE
FT                   APEAHRRGEWWQLSYCTQSVGGPEGLQSTQAMAFLYRSYVCGEEQPQQISVASGTPVSA
FT                   DQTPATPQEQPRAPWWDASPGVQRLITLKDPQVVCEAASAGLLKTLRFVKYLPCFQILP
FT                   LDQQLVLVRSCWAPLLMLELAQDHLHFEMMEIPETNTTQEMLTTRRQETEGPEPAEPQA
FT                   TEQPQMVSAEAGHLLPAAAVQAIKSFFFKCWSLNIDTKEYAYLKGTVLFNPDLPGLQCV
FT                   KYIEGLQWRTQQILTEHIRMMQREYQIRSAELNSALFLLRFINSDVVTELFFRPIIGAV
FT                   SMDDMMLEMLCAKL"
FT   regulatory      1771..1776
FT                   /note="putative"
FT                   /regulatory_class="polyA_signal_sequence"
FT   polyA_site      1795
FT                   /note="putative"
XX
SQ   Sequence 1795 BP; 418 A; 483 C; 508 G; 386 T; 0 other;
     gagaacgagc tacaggagcc tcaggccatg gcgggtgagg accacccgtg gcagggcagc        60
     atcctctaca atctactgat gagcgcgaag cagaagcacg cgtctcagga agagcgagag       120
     gtgcgcttgg gggctcagtg ctggggttgc gcctgcggtg ctcagcccgt cctgggtggg       180
     gagagactgt ccggcgggca agccaggtcc ctcttgtacc gctgctgctt ttgtggggag       240
     aatcacccgc gccagggtgg catcctctac tctatgctca ccaacgccag gcagccaagc       300
     gtggcgaccc aggcgccgag ggcacgattc ggagcacctt gctggggctg cgcctgcggc       360
     agcgcagagc ccctggtggg cagagagggg ctgccggctg gccaggcccc ctcgctcctg       420
     taccgctgct gcttctgcgg agaagagcac ccgaggcagg gcagcatctt atacagcttg       480
     ctcactagcg ctcagcaaac gcacgtgtct cgggaagcac ccgaggcaca tcgcagaggc       540
     gagtggtggc agctgtccta ctgtacccag agtgtgggtg gcccagaggg gctgcagagc       600
     acacaggcca tggcgttcct gtaccgcagc tatgtgtgcg gtgaagagca gccccagcag       660
     atcagcgttg cctctggcac gcccgtgagc gcagaccaaa caccagcgac cccgcaagag       720
     cagccgaggg ctccctggtg ggacgcctca cctggtgtgc agcgtctgat cacactcaag       780
     gatccacagg tggtgtgcga ggcagcgtcc gctggcctgt tgaagaccct gcgctttgtc       840
     aagtacttgc cctgcttcca gatcctgccc ctagatcagc agctggtgct ggtgcggagc       900
     tgttgggcgc ccctactcat gcttgagttg gcccaagatc acctgcactt cgagatgatg       960
     gagatcccgg agaccaacac gacgcaggaa atgcttacca ccaggcggca ggagaccgaa      1020
     ggtccagagc ctgcagagcc ccaggccaca gagcagccac agatggtgtc cgcggaggct      1080
     gggcacttgc tcccagctgc tgcggtccag gccatcaaga gtttcttttt caagtgctgg      1140
     agtctgaaca ttgacaccaa agagtatgcc tatctgaaag ggaccgtgct ctttaaccca      1200
     gacctgcctg gcctgcagtg cgtgaaatac attgagggtc ttcagtggag aacccagcag      1260
     atccttactg agcacatccg gatgatgcag agagagtacc agatcagatc cgctgaactg      1320
     aacagtgccc ttttcctgct gagattcatc aatagcgatg tcgtcactga actctttttc      1380
     aggcccatca ttggtgcagt cagcatggat gatatgatgc tggagatgct ctgtgcaaag      1440
     ctgtgaaggc atatgtccac tcaagtgcat tttactatag atggagaaag cggtcgtagc      1500
     tgtaggcaga ggagtgctaa aatttgtgaa accaaacttt cttgtatttt tacatgcata      1560
     gtatatttgt attcaattga agaaatactt tagttacaat gtaaaaatcc ctctgctcca      1620
     tactggcttc ttgtgaagga aagcatttgc aaacaaatca ctatttctgt atatctctaa      1680
     gagtgtggta ctaggctaac aagctaattt cataaaaata acatctcttt ccattaaccc      1740
     cgccaaataa aatttataat attaactttt aataaaattt aaggtactaa ccgtt           1795
//