spacer

EBI Dbfetch

ID   AK140770; SV 1; linear; mRNA; HTC; MUS; 2017 BP.
XX
AC   AK140770;
XX
DT   06-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 11)
XX
DE   Mus musculus 16 days embryo head cDNA, RIKEN full-length enriched library,
DE   clone:C130013P12 product:G protein-coupled receptor 19, full insert
DE   sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2017
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (30-MAR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 1978381779142a5a400af9766b0de975.
DR   Ensembl-Gn; ENSMUSG00000032641; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000046255; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000066107; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000111932; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000116515; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000165392; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=C130013P12
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2017
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /dev_stage="16 days embryo"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="C130013P12"
FT                   /tissue_type="head"
FT                   /db_xref="taxon:10090"
FT   CDS             689..1918
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="G protein-coupled receptor 19 (MGD|MGI:892973
FT                   GB|BC021648, evidence: BLASTN, 100%, match=1290)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q61121"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:892973"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q61121"
FT                   /protein_id="BAE24474.1"
FT                   /translation="MDNDQPPVVTATLLVPLQNSSCAEAAEALLPHGLMGLHEEHSWMS
FT                   NRTELQYELNPGEVATASIFFGALWLFSIFGNSLVCLVIHRSRRTQSTTNYFVVSMACA
FT                   DLLISVASTPFVVLQFTTGRWTLGSAMCKVVRYFQYLTPGVQIYVLLSICIDRFYTIVY
FT                   PLSFKVSREKAKKMIAASWILDAAFVTPVFFFYGSNWDSHCNYFLPPSWEGTAYTVIHF
FT                   LVGFVIPSILIILFYQKVIKYIWRIGTDGRTLRRTMNIVPRTKVKTVKMFLLLNLVFLF
FT                   SWLPFHVAQLWHPHEQDYKKSSLVFTAVTWVSFSSSASKPTLYSIYNANFRRGMKETFC
FT                   MSSMKCYRSNAYTITTSSRMAKRNYVGISEIPPVSRTITKDSIYDSFDREAREKKLAWP
FT                   INSNPPNTFV"
XX
SQ   Sequence 2017 BP; 461 A; 550 C; 494 G; 512 T; 0 other;
     gagaacttcc tgcttggtca caggtggccc cgtcggcccc cgagggatgt cagtcagggg        60
     acgtggaaca cctgcacaaa ctggattttt gccctatcac gactctgagg taccatccgg       120
     caactgaagt gtcctctttc caatagaatg cctggcctct cccaccaact tcacggttca       180
     gccggaatga aatttggcta acaagtcact cagatgagtc actggctcat tacaagatta       240
     tagatttcta atctatagcc ttccagttgt gtagatctta ggattcactc taatattggg       300
     agcagtgcta tatagtacag acagtattgt catttttact gtccctggag attgtttgca       360
     ggaccttgca caagtcccgc aatgcatgat gctcaagtcc cctgcgtaat gaggaagcag       420
     gctgagggct gagggaaggc aaaggggaga tatgaatgtg ttccgaaggt ttcccggtgg       480
     ctcatggcat cctccaaagt cctgcctgcg agctgttcct gaccaagaaa acccgcggag       540
     cctgactctg aaatccagtc ccgatgaaga ggaggtgata ttcatgtgtc ctggctcaca       600
     cgtgaagcag agggcttctt ggagttggtt cttccctttc ccctttattc agttctggca       660
     atggaactca agtgtccagg ctttcagaat ggataacgac cagccgcctg tggtgactgc       720
     caccctgctg gtgccccttc agaacagcag ctgcgcggaa gcagctgagg ccctgctgcc       780
     ccatggcctg atgggattgc atgaggagca cagctggatg agcaacagga cagagcttca       840
     gtacgagctg aaccctggag aggtggccac cgccagcatc ttctttggcg ctttgtggtt       900
     gttctccatc tttggcaatt ccctggtatg tctggtcatc caccggagcc ggaggactca       960
     gtccaccacc aactacttcg tggtgtccat ggcgtgtgct gaccttctca tcagcgtggc      1020
     cagcacgccg tttgtcgtgc tgcagttcac caccgggagg tggaccctgg gtagcgccat      1080
     gtgcaaggtg gtccgctact tccagtacct cacccccggc gtgcagatct acgtgctgct      1140
     ctccatctgc atcgaccgct tctataccat cgtctacccg ctgagcttca aggtgtcccg      1200
     agagaaggcc aagaaaatga ttgcagcctc ctggatcttg gacgcggcct tcgtgacgcc      1260
     tgtcttcttt ttctacggct ctaactggga tagtcactgt aactacttcc tccctccctc      1320
     ctgggaggga actgcctata ccgtcatcca cttcttggtg ggcttcgtga ttccctccat      1380
     cctcataatc ctgttttacc agaaggtcat aaagtatatc tggagaatag gcacggacgg      1440
     gcggacgctg agaaggacga tgaacattgt ccccaggaca aaggtgaaaa cggtcaagat      1500
     gttcctgctc ttgaacctag tgttcctgtt ctcctggcta cctttccatg tggctcagct      1560
     ctggcatccc catgagcaag actacaagaa gagctccctt gtcttcacgg cagtcacgtg      1620
     ggtatctttc agctcttcag cctcgaaacc cactctgtac tctatttata atgccaattt      1680
     tcggagaggg atgaaagaga cattctgcat gtcctcgatg aaatgctacc gcagcaatgc      1740
     ctacaccatc acgaccagct cacggatggc caaaagaaac tatgtgggca tttcggaaat      1800
     ccctcccgtg agcaggacca taaccaaaga ctccatctat gactcatttg accgggaggc      1860
     cagggagaag aagctcgcct ggcccatcaa ctcaaaccct ccaaacactt ttgtctgatt      1920
     tctaagaagt ctttcactgt tatgtgccag agattaaaaa gctttcacta taaagtgaga      1980
     attgatttac ttagttttca ctaaacttcc gttttgc                               2017
//


spacer
spacer