spacer

EBI Dbfetch

ID   AK140464; SV 1; linear; mRNA; HTC; MUS; 2071 BP.
XX
AC   AK140464;
XX
DT   06-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 10)
XX
DE   Mus musculus 10 days neonate medulla oblongata cDNA, RIKEN full-length
DE   enriched library, clone:B830043I03 product:G-protein coupled receptor 3,
DE   full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2071
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (30-MAR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; bf9d0ff83c3273d171099d01ff9c68b5.
DR   Ensembl-Gn; ENSMUSG00000049649; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000052090; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000105911; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=B830043I03
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2071
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /dev_stage="10 days neonate"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="B830043I03"
FT                   /tissue_type="medulla oblongata"
FT                   /db_xref="taxon:10090"
FT   CDS             78..1070
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="G-protein coupled receptor 3 (MGD|MGI:101908
FT                   GB|NM_008154, evidence: BLASTN, 99%, match=1998)"
FT                   /note="putative"
FT                   /db_xref="GOA:P35413"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000723"
FT                   /db_xref="InterPro:IPR000984"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:101908"
FT                   /db_xref="UniProtKB/Swiss-Prot:P35413"
FT                   /protein_id="BAE24399.1"
FT                   /translation="MMWGAGSSMAWFSAGSGSVNVSSVDPVEEPTGPATLLPSPRAWDV
FT                   VLCISGTLVSCENALVVAIIVGTPAFRAPMFLLVGSLAVADLLAGLGLVLHFAADFCIG
FT                   SPEMSLMLVGVLAMAFTASIGSLLAITVDRYLSLYNALTYYSETTVTRTYVMLALVWVG
FT                   ALGLGLVPVLAWNCRDGLTTCGVVYPLSKNHLVVLAIAFFMVFGIMLQLYAQICRIVCR
FT                   HAQQIALQRHLLPASHYVATRKGIATLAVVLGAFAACWLPFTVYCLLGDADSPRLYTYL
FT                   TLLPATYNSMINPVIYAFRNQDVQKVLWAICCCCSTSKIPFRSRSPSDV"
XX
SQ   Sequence 2071 BP; 400 A; 613 C; 531 G; 527 T; 0 other;
     ggcacacctt gctctgccag aacctgagtg gaggcgcccc gcggcccggc cgcacccggt        60
     cctgagccac cggtaccatg atgtggggag caggaagctc tatggcctgg ttctcagctg       120
     gctcaggcag tgtgaacgtg agcagcgtgg acccagtaga ggaacccaca ggcccagcta       180
     cactgctgcc ctctcccagg gcctgggatg tggtgctgtg catctcaggc accctggtgt       240
     cctgcgagaa cgcgctggtg gtggccatca ttgtgggcac tcctgccttc cgcgccccca       300
     tgttcctgct ggtgggtagc ttggccgtag cagacctgct ggcaggcctg ggcctggtcc       360
     tgcactttgc ggctgacttc tgcattggct caccagagat gagcttgatg ctggtcggcg       420
     tgctagcaat ggccttcact gccagcatcg gcagcctgct ggccattacc gttgaccgct       480
     acctttccct gtacaatgct ctcacttact actcagagac aacggtaact cggacttatg       540
     tgatgctggc cttggtgtgg gtgggtgccc tgggcctggg gctggttccc gtgctggcct       600
     ggaactgccg ggatggcctg accacgtgtg gtgtggtcta tccactctcc aagaaccatc       660
     tggtggttct ggccatcgcc ttcttcatgg tgtttggcat catgttgcag ctctatgccc       720
     agatctgccg catcgtctgc cgccatgccc agcagatcgc cctccaacga cacctgctgc       780
     ctgcctctca ctacgtggcc acccgcaagg gcatcgccac attggctgtg gtgcttggcg       840
     cctttgctgc ctgttggttg cccttcactg tctactgcct cctgggagat gccgactctc       900
     cccgtctcta cacctatctt accctgctcc cagccaccta caactccatg atcaaccctg       960
     tcatctacgc ctttcgcaac caagatgtgc agaaggtgct gtgggccatc tgctgctgct      1020
     gttccacttc caagattcca ttccggtccc ggtcccctag tgatgtctag tttcatcctg      1080
     gtgaacctgt ggctttgact actatagaac tccagagtgt taggtccacc agggcttaat      1140
     tccaatcccc agctccacgc ccttaagacc cagctggttc tggagttcta ggacgttggg      1200
     tgttttagga tcttattcaa gattcctgcg gggggcccac cccagctgac cgcgtggctc      1260
     tagaatgttc cagatggtca gggtcccact cggaaatgtc tcacagccca agtggtttgc      1320
     agttccagaa ggctgggaat tttacagtac cattccaagt ccttgatctt ccttcccaga      1380
     aacttgacct tgatcatgtc gcttttgaat ttcgaagctc cagagtcaga ggttaatcac      1440
     ttagttgcct agatgagaga aagatttatc tctatatatg tggacataca gagaaggttt      1500
     atttatttat ttattattta tttatttata aatttgctta tgggtggtaa gggggaaaaa      1560
     agagacctac acctagaaat ctagctcata tcagggtatc ctcagcctcc atgaccccat      1620
     ttctgacctc agtttccgaa gggggcggga tggaaaaaga gaaaccacgt attttgttat      1680
     ttttgcttat tttttatcag agaaatcata gaaaccagag cctcctcccc aggcccgcac      1740
     tgctcgggtt tgcagggaga acacaccagc ctctggtttt ttattttttt aagaagccat      1800
     cacctgagca accgagaatt cctctgcgct gaggcccggc ttccctctgg tggccatttg      1860
     ggggaattgc aaaccgacaa ggcagtcggg attgtaaaat gcacccccat ctctcactcc      1920
     agcctggctt tcagcgccac agccatggcc tgggggccag gccttaccct gaggtgcccg      1980
     agaggaggcg ggacaagagc cagtaccccc acccctctgc caatcgggtt atggccccca      2040
     gtgcattcct gttcagtccc caaccctacc c                                     2071
//


spacer
spacer