Dbfetch

ID   AK140456; SV 1; linear; mRNA; HTC; MUS; 3309 BP.
XX
AC   AK140456;
XX
DT   06-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 10)
XX
DE   Mus musculus 10 days neonate medulla oblongata cDNA, RIKEN full-length
DE   enriched library, clone:B830039J05 product:reticulon 4 receptor-like 1,
DE   full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-3309
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (30-MAR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; dafc9eac18339ae67e4c09b3ac466e3f.
DR   Ensembl-Gn; ENSMUSG00000045287; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0018707; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0018673; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0018643; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0018647; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0018460; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019098; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018014; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0018430; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0018539; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0018529; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0018610; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0018555; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019138; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0017785; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018067; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000102514; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0030691; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0030628; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0030609; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0030623; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0030415; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0031130; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0030131; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0030328; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0030465; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0030464; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0030590; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0030448; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0031154; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0029848; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0029899; mus_musculus_wsbeij.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=B830039J05
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3309
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /dev_stage="10 days neonate"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="B830039J05"
FT                   /tissue_type="medulla oblongata"
FT                   /db_xref="taxon:10090"
FT   CDS             291..1628
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="putative"
FT                   /note="reticulon 4 receptor-like 1 (MGD|MGI:2661375
FT                   GB|NM_177708, evidence: BLASTN, 100%, match=2446)"
FT                   /db_xref="GOA:Q8K0S5"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR003591"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="MGI:MGI:2661375"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8K0S5"
FT                   /protein_id="BAE24396.1"
FT                   /translation="MLRKGCCVELLLLLLAGELPLGGGCPRDCVCYPAPMTVSCQAHNF
FT                   AAIPEGIPEDSERIFLQNNRITFLQQGHFSPAMVTLWIYSNNITFIAPNTFEGFVHLEE
FT                   LDLGDNRQLRTLAPETFQGLVKLHALYLYKCGLSALPAGIFGGLHSLQYLYLQDNHIEY
FT                   LQDDIFVDLVNLSHLFLHGNKLWSLGQGIFRGLVNLDRLLLHENQLQWVHHKAFHDLHR
FT                   LTTLFLFNNSLTELQGDCLAPLVALEFLRLNGNAWDCGCRARSLWEWLRRFRGSSSAVP
FT                   CATPELRQGQDLKLLRVEDFRNCTGPVSPHQIKSHTLTTSDRAARKEHHPSHGASRDKG
FT                   HPHGHPPGSRSGYKKAGKNCTSHRNRNQISKVSSGKELTELQDYAPDYQHKFSFDIMPT
FT                   ARPKRKGKCARRTPIRAPSGVQQASSGTALGAPLLAWILGLAVTLR"
FT   regulatory      3293..3298
FT                   /note="putative"
FT                   /regulatory_class="polyA_signal_sequence"
FT   polyA_site      3309
FT                   /note="putative"
XX
SQ   Sequence 3309 BP; 755 A; 954 C; 898 G; 702 T; 0 other;
     gggcagaatc aggccgccgg ctcggcggag caagccactc gcccggggct gagcgagcgc        60
     accgcgttgg ttggcagcgc cgcggttgct agcaggcgcc ggtgccctga gcaccgggtt       120
     tgggctcacc atgcccctgc gggaccgggc cgccgggcac aagcggattc ccggcttgcc       180
     cccgcctcga cgcgctcgga ttagctgcag ctggcgccca gggatttgaa tctggacccc       240
     aggagggagc gcgcctaggc cgacctcgga gcggcggccc cgcggccaac atgcttcgca       300
     aagggtgctg tgtggaattg ctgctgttgc tgctcgctgg agagctacct ctgggtggtg       360
     gttgtcctcg agactgtgtg tgctaccctg cgcccatgac tgtcagctgc caggcacaca       420
     actttgctgc catcccggag ggcatcccag aggacagtga gcgcatcttc ctgcagaaca       480
     atcgcatcac cttcctccag cagggccact tcagccccgc catggtcacc ctctggatct       540
     actccaacaa catcactttc attgctccca acaccttcga gggctttgtg catctggagg       600
     agctagacct tggagacaac cgacagctgc gaacgctggc acccgagacc ttccaaggcc       660
     tggtgaagct tcacgccctc tacctctata agtgtggact gagcgccctg cccgcaggca       720
     tctttggtgg cctgcacagc ctgcagtatc tctacttgca ggacaaccat atcgagtacc       780
     tccaagatga catctttgtg gacctggtca atctcagtca cttgtttctc catggtaaca       840
     agctatggag cctgggccaa ggcatcttcc ggggcctggt gaacctggac cggttgctgc       900
     tgcatgagaa ccagctacag tgggttcacc acaaggcttt ccatgacctc cacaggctaa       960
     ccaccctctt tctcttcaac aacagcctca ctgagctgca gggtgactgt ctggcccccc      1020
     tggtggcctt ggagttcctt cgcctcaatg ggaatgcttg ggactgtggc tgccgggcac      1080
     gttccctgtg ggaatggctg cgaaggttcc gtggctctag ctctgctgtc ccctgcgcga      1140
     cccccgagct gcggcaaggc caggatctga agctgctgag ggtggaggac ttccggaact      1200
     gcacaggacc agtgtctcct caccagatca agtctcacac gcttaccacc tctgacaggg      1260
     ctgcccgcaa ggagcaccat ccgtcccatg gggcctccag ggacaaaggc cacccacatg      1320
     gccatccgcc tggctccagg tcaggttaca agaaggcagg caagaactgc accagccaca      1380
     ggaaccggaa ccagatctct aaggtgagct ctgggaaaga gcttaccgaa ctgcaggact      1440
     atgcccccga ctatcagcac aagttcagct ttgacatcat gcccaccgca cgacccaaga      1500
     ggaagggcaa gtgtgctcgc aggaccccca tccgtgcccc cagtggggtg cagcaggcat      1560
     cctcaggcac ggcccttggg gccccactcc tggcctggat actggggctg gcagtcactc      1620
     tccgctgagg acccagggct ccgtcaccca gcactgccac atgtccagca aggaacagaa      1680
     tttttttctt cttttctttc tttctttctt ttttttttcc taagtggaag atctgctggg      1740
     tttcaggaaa aggctgctga agccttcagc caccgtctgg acccttcctg gtggattata      1800
     agcccaaaat gtacagccgt agacgggaag ggtatcacgt ctcactcggc tgtcctgacc      1860
     gagcgcctct ggaccgtatc cactccagca cagtggtcaa aggcacgcaa agtgagtcat      1920
     tagtggtgtc gggacatgcg ccccttgaag aagctgggct ctgcggaagc ctggtcattt      1980
     ggagagaagg gctgaaggac cctgctggtt ttggaaggag caggactcag aacaaggctc      2040
     tcccagagcc agctggggca accagcaatc tcagagcact cttggctctt gtctgagatc      2100
     acttagttaa cctgccctgt ccaaccctat gccaccctca gtccctatcc atgggggtaa      2160
     tgcctctcat tcctgacgtc tcaggcagcc cccggcagac ctgctggggt ccaagaacca      2220
     atcaccaaag gagagatcgc cagtggatga catttagaac tgtactcgca atgagagtca      2280
     cacagaaggt gcagttttat acctatgtcc acttatatat atcctcactc tgcccacaca      2340
     cccacataat atatatatat atataaatat ataaatgcac aggtccccca acccactcct      2400
     taccaaactg tatgtcttat catgtttata aactatacgg gaacctatat ttgctcaatt      2460
     aaggactgta tcggtaactt ctagcaagaa aaaaaaaaac aaaaaactgc ggcaattttg      2520
     ttcagaaccc cagccagcaa caatagtccc tgggcttgct gggggcaaag gtgtcagtgg      2580
     gaagagtcgg gaaggaagag aagcagcaag aatcacttca ggggaccaac attcttagat      2640
     acttagaaca tcacctcgtt tttatatgca acacacgcct gtctggcacc ccggagcacc      2700
     ccgtcacccc tactgtagaa gctgcagaca ttagcgagag aagtggatgt cagggtgctg      2760
     gaggcaagct aggcggagct ggggaagagg tttctggggt tttcaagctg gcagacaagg      2820
     cagcgtctac agtgttagtc caatgggttg gatggacaat gtccttctta gcactttgtg      2880
     caggccaggg aggctctgag ctctggcctc aggagaggct ttagctgcag ttttaacatc      2940
     taggctcttt ggccagtgac ctactgaggg ccctgagtag tctggcagtg ggaaaaaaat      3000
     ctagtggcct tagcagatga gggtgtttca gtagccatct caggaaccct gtatcacagt      3060
     ggtcctgctc ctcctggatg accccaggac gggcagaggt cagagggcca gactcagggg      3120
     tcagcccaga aggcagcctg caggcaagcc cagtcaggga atagggctgt tggcccaagg      3180
     gtttctggca agcacagtct cttgtgctct gcatagacag acctgaattc cctaccagag      3240
     aggatacctg aggagtaaga aatgctgaat ccaattaaga gagaaaaata ataataaaaa      3300
     ttctcttgg                                                              3309
//