Dbfetch

ID   AK140423; SV 1; linear; mRNA; HTC; MUS; 4044 BP.
XX
AC   AK140423;
XX
DT   06-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 11)
XX
DE   Mus musculus 6 days neonate medulla oblongata cDNA, RIKEN full-length
DE   enriched library, clone:B730043P22 product:gamma-aminobutyric acid (GABA-A)
DE   transporter 4, full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-4044
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (30-MAR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 8779dfdf98bd3f8ac3136e98d13f4518.
DR   Ensembl-Gn; ENSMUSG00000030307; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0031139; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0031108; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0031039; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0031119; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0030589; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0031578; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0030226; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0030805; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0030958; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0030912; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0031038; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0030946; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0031605; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0029942; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0030310; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000032451; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0079406; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0079477; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0079400; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0079420; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0077880; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0079896; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0079628; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0079005; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0079157; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0079042; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0079190; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0079047; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0080144; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0079055; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0078150; mus_musculus_wsbeij.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=B730043P22
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4044
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /dev_stage="6 days neonate"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="B730043P22"
FT                   /tissue_type="medulla oblongata"
FT                   /db_xref="taxon:10090"
FT   CDS             40..1923
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="gamma-aminobutyric acid (GABA-A) transporter 4
FT                   (MGD|MGI:95630 GB|AK053078, evidence: BLASTN, 99%,
FT                   match=4041)"
FT                   /note="putative"
FT                   /db_xref="GOA:P31650"
FT                   /db_xref="InterPro:IPR000175"
FT                   /db_xref="InterPro:IPR002982"
FT                   /db_xref="MGI:MGI:95630"
FT                   /db_xref="UniProtKB/Swiss-Prot:P31650"
FT                   /protein_id="BAE24379.1"
FT                   /translation="MTAEQALPLGNGKAAEEARGSETLGGGGGGAAGTREARDKAVHER
FT                   GHWNNKVEFVLSVAGEIIGLGNVWRFPYLCYKNGGGAFLIPYVVFFICCGIPVFFLETA
FT                   LGQFTSEGGITCWRRVCPLFEGIGYATQVIEAHLNVYYIIILAWAIFYLSNCFTTELPW
FT                   ATCGHEWNTEKCVEFQKLNFSNYSHVSLQNATSPVMEFWERRVLAISDGIEHIGNLRWE
FT                   LALCLLAAWTICYFCIWKGTKSTGKVVYVTATFPYIMLLILLIRGVTLPGASEGIKFYL
FT                   YPDLSRLSDPQVWVDAGTQIFFSYAICLGCLTALGSYNNYNNNCYRDCIMLCCLNSGTS
FT                   FVAGFAIFSVLGFMAYEQGVPIAEVAESGPGLAFIAYPKAVTMMPLSPLWATLFFMMLI
FT                   FLGLDSQFVCVESLVTAVVDMYPKVFRRGYRRELLILALSIISYFLGLVMLTEGGMYIF
FT                   QLFDSYAASGMCLLFVAIFECVCIGWVYGSNRFYDNIEDMIGYRPLSLIKWCWKVVTPG
FT                   ICAGIFIFFLVKYKPLKYNNVYTYPAWGYGIGWLMALSSMLCIPLWIFIKLWKTEGTLP
FT                   EKLQKLTVPSADLKMRGKLGASPRTVTVNDCEAKVKGDGTISAITEKETHF"
FT   regulatory      4022..4027
FT                   /note="putative"
FT                   /regulatory_class="polyA_signal_sequence"
FT   polyA_site      4044
FT                   /note="putative"
XX
SQ   Sequence 4044 BP; 780 A; 1136 C; 1062 G; 1066 T; 0 other;
     ggcagagccg gggccggcgc acgaggcggc agggcggcca tgactgcgga gcaagcgctg        60
     cccctgggca acgggaaagc ggccgaggag gcgcgggggt ccgagacgct gggcggcggc       120
     ggcgggggcg cggcggggac gcgcgaggcg cgcgacaagg ctgtccacga gcgcggccac       180
     tggaacaaca aggtggagtt cgtgttgagc gtagctggag agatcatcgg actgggcaac       240
     gtgtggcgct ttccctacct gtgctacaaa aacggcggag gggcattcct gattccttac       300
     gtggtgtttt tcatctgctg cggaatcccc gtcttcttcc tggaaacggc tctggggcag       360
     ttcacgagcg agggtggcat cacgtgctgg aggagggtct gccctttatt tgaaggcatt       420
     ggctatgcaa cacaggtgat cgaggcacac ctcaatgtct actacatcat catcctggcg       480
     tgggccatct tctacctaag caattgcttc accaccgagc tcccctgggc cacctgtggg       540
     cacgagtgga acacagagaa atgtgtggag ttccagaagc tgaacttcag caactacagt       600
     catgtgtccc tgcagaatgc cacctccccg gtcatggagt tctgggaacg ccgggtcttg       660
     gctatatccg atggcattga gcacattggg aacctccgtt gggaactggc attatgtctc       720
     ctggcggcct ggaccatctg ctacttctgc atatggaagg gtactaagtc gactggaaag       780
     gtcgtgtatg tcactgcaac cttcccctac atcatgctgc tgatcctcct gatccgaggg       840
     gtcacgttgc caggcgcctc tgaaggcatc aagttctatc tgtaccctga cctctcccgg       900
     ctctctgacc cacaggtgtg ggtggacgct gggacgcaga tctttttctc ctatgccatc       960
     tgcctgggct gcctaaccgc tctggggagt tacaacaact ataacaacaa ctgctacagg      1020
     gactgcatta tgctctgctg tctaaacagt ggcaccagct tcgtggctgg gtttgccatc      1080
     ttctcagtcc tgggcttcat ggcatacgag cagggtgtgc ctattgccga ggtggcagag      1140
     tcaggtcctg gactggcttt catcgcctac cccaaggctg tcactatgat gcccctctct      1200
     ccactgtggg ccaccttgtt cttcatgatg ctcatcttcc tgggcctgga cagtcagttt      1260
     gtgtgcgtgg agagtcttgt gacagccgtg gtagacatgt accctaaggt cttccggcgg      1320
     ggctaccggc gagaactgct catcctggcc ctgtccatca tctcctattt cctaggcctg      1380
     gtgatgctga ccgagggagg catgtacatc ttccagcttt ttgactcata cgccgccagt      1440
     ggcatgtgct tgctctttgt ggccatcttt gagtgtgtct gcatcggctg ggtatatgga      1500
     agcaaccggt tctatgacaa tattgaggat atgattggtt accggccact gtcactcatc      1560
     aagtggtgct ggaaagtcgt gacccctggg atctgtgcgg gcatcttcat cttctttctg      1620
     gtcaagtaca aaccgctcaa gtacaacaat gtgtacacat atcctgcttg gggctacggc      1680
     atcggctggc tcatggctct gtcctccatg ctgtgtatcc cactctggat cttcattaag      1740
     ctgtggaaga cagagggcac actgcccgag aaattacaga agttgacagt ccccagcgcc      1800
     gatctgaaaa tgcggggcaa gcttggggcc agcccacgga cggtgaccgt taatgactgt      1860
     gaggccaagg tcaagggcga cggcaccatc tctgccatca cagagaagga gacacacttc      1920
     tgagtcccca ccagccattt ggatgcggct ccaaccttcc ttccctgcgt gtaaatgaat      1980
     cctgaacctc gtacttcacc taatgttagg ggcttgctcg tctgcacagg acttattaac      2040
     aagttaactc ccagccggcc actgtgtgcc ctgtaccctt gcctcttccc agtgatagtg      2100
     ggcatatcca cctcaccaag ataattctgt acagtgacta gcagatcctg gcctagggtg      2160
     gctcagccgg tgttttctag agtccttgta ttatatactg tcaactcgta tgctgggggc      2220
     aggtggagtg ggggagcggt gcccatctgc ctctgatgtt cagtcattcc tggttttatc      2280
     tctgaacttc cctggccacc ctcctctgtg ccctgggacc agtttgtttt attttatttt      2340
     tttttctttt ggtcttcccc ttttcctagt gacaccttcc acatgtcaat gtcgtaagac      2400
     agagagcaaa gcctcccacc atcgttagga ctcctgagta accaggagtt gctgactgtc      2460
     ccttcaagtg actgtggctc ctttctctcc ctggccccta gtttctccat ctcccagacc      2520
     aagggggcga gggggttgag tggagtcttc ccttcaaagc agggaagaat acctgactcg      2580
     ttgcttcgca gagctgcttt gacctgcaga gacttgtaga cctcttctct tctctgtccc      2640
     cttggttacc acctacccac cttgcctatt ttaagtgaaa cttaccacca atgatgtggg      2700
     gaagtgtgtt tccctaacaa ctggagtttt agcctaaccc tgatccctta actggtgcac      2760
     cccagccccc gtgttcgggg ctcccaccat ctgtccagcc ttcttggcca ccagctctgt      2820
     ccctccttcc tagataggga tgatcagaag gtagccatct cttcttgcag ctgcctggcc      2880
     aggatctatg gcttaggatc tatggccacc cctgcagggg agctacagtg aggcctgggg      2940
     ctggattcca cccacagtcc cttccctgtg caccctgctt tgtcccctgc cttgtcccct      3000
     gctctctctt ctacctacct gcctacccct gcagatcctg tgggcagaca ccttactctg      3060
     gagccattcc acctgcctgt cacctgggtc tgagaagcct tcacttccac ttgccagagg      3120
     gaagaactgg ccacccatct gtcaggctct tccttggaaa cgaagagcag aggtggtctc      3180
     tagggggagg gctggtgcca ttccctcctg cctggctcag acctcttaga ctggtctctc      3240
     ttcctcagct gctgggttct ttgtctgccc agctattgga ggatgggaag tggagggagg      3300
     gtcactcttt ccctcttact gtagtttcct agatttatct gaggaaaagt gagatgtctt      3360
     cacgctaagg ctccagtgtt ctgtcagaga cctgaatgct ctatttgccc aatgcttcca      3420
     gactcttagc tgttctgccc agcccccgtc ccgctcccac ctaaagcctg agttggctga      3480
     gccaaatgcc cagcactgcc cccacctaac tgggcacttg tctagggcac accaccccca      3540
     gctgctcaca cacagaccac atattccttc tgggaaggcc agcatcatcc tgaagatgac      3600
     ctgtggggtt ggtccttgat ggctgtcccc tccaccctac ccctgagaag ggaagctgcc      3660
     cgttgctgct actgcacctc accaccaact ccctcatgga cagacagatc cctgatgtct      3720
     gtcactatag acacacgtgt tgtacatgtg gcccttaaca cttgacactc ttaacactac      3780
     tcatggggct gggtagaggg aggcttgtgg tttggggggt tgttattttt tgctttcttt      3840
     tcttcctttc ttttttcttt ttgtcttttt ttgtaatttc atactagtat ttgggtaact      3900
     gtagggagga ggggagggta agtgggggca agtgggggca aggggacata tcattgtgac      3960
     aacttttttg atatttacta gaaatgatgc aatatatcct ttctgagata tttacagtat      4020
     tattaaaggg ttgggctgtt ttgc                                             4044
//