Dbfetch

ID   AK140302; SV 1; linear; mRNA; HTC; MUS; 2113 BP.
XX
AC   AK140302;
XX
DT   06-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 11)
XX
DE   Mus musculus adult male corpora quadrigemina cDNA, RIKEN full-length
DE   enriched library, clone:B230399B16 product:G-protein coupled receptor 3,
DE   full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2113
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (30-MAR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 3e1abcc4600e0e6c9bc6f97767b65cdd.
DR   Ensembl-Gn; ENSMUSG00000049649; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000052090; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000105911; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=B230399B16
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2113
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /sex="male"
FT                   /dev_stage="adult"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="B230399B16"
FT                   /tissue_type="corpora quadrigemina"
FT                   /db_xref="taxon:10090"
FT   CDS             95..1087
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="G-protein coupled receptor 3 (MGD|MGI:101908
FT                   GB|NM_008154, evidence: BLASTN, 99%, match=2000)"
FT                   /note="putative"
FT                   /db_xref="GOA:P35413"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000723"
FT                   /db_xref="InterPro:IPR000984"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:101908"
FT                   /db_xref="UniProtKB/Swiss-Prot:P35413"
FT                   /protein_id="BAE24325.1"
FT                   /translation="MMWGAGSSMAWFSAGSGSVNVSSVDPVEEPTGPATLLPSPRAWDV
FT                   VLCISGTLVSCENALVVAIIVGTPAFRAPMFLLVGSLAVADLLAGLGLVLHFAADFCIG
FT                   SPEMSLMLVGVLAMAFTASIGSLLAITVDRYLSLYNALTYYSETTVTRTYVMLALVWVG
FT                   ALGLGLVPVLAWNCRDGLTTCGVVYPLSKNHLVVLAIAFFMVFGIMLQLYAQICRIVCR
FT                   HAQQIALQRHLLPASHYVATRKGIATLAVVLGAFAACWLPFTVYCLLGDADSPRLYTYL
FT                   TLLPATYNSMINPVIYAFRNQDVQKVLWAICCCCSTSKIPFRSRSPSDV"
FT   regulatory      2089..2094
FT                   /note="putative"
FT                   /regulatory_class="polyA_signal_sequence"
FT   polyA_site      2113
FT                   /note="putative"
XX
SQ   Sequence 2113 BP; 412 A; 617 C; 542 G; 542 T; 0 other;
     gggcttcttg gggtccgcgc acaccttgct ctgccagaac ctgagtggag gcgccccgcg        60
     gcccggccgc acccggtcct gagccaccgg taccatgatg tggggagcag gaagctctat       120
     ggcctggttc tcagctggct caggcagtgt gaacgtgagc agcgtggacc cagtagagga       180
     acccacaggc ccagctacac tgctgccctc tcccagggcc tgggatgtgg tgctgtgcat       240
     ctcaggcacc ctggtgtcct gcgagaacgc gctggtggtg gccatcattg tgggcactcc       300
     tgccttccgc gcccccatgt tcctgctggt gggtagcttg gccgtagcag acctgctggc       360
     aggcctgggc ctggtcctgc actttgcggc tgacttctgc attggctcac cagagatgag       420
     cttgatgctg gtcggcgtgc tagcaatggc cttcactgcc agcatcggca gcctgctggc       480
     cattaccgtt gaccgctacc tttccctgta caatgctctc acttactact cagagacaac       540
     ggtaactcgg acttatgtga tgctggcctt ggtgtgggtg ggtgccctgg gcctggggct       600
     ggttcccgtg ctggcctgga actgccggga tggcctgacc acgtgtggtg tggtctatcc       660
     actctccaag aaccatctgg tggttctggc catcgccttc ttcatggtgt ttggcatcat       720
     gttgcagctc tatgcccaga tctgccgcat cgtctgccgc catgcccagc agatcgccct       780
     ccaacgacac ctgctgcctg cctctcacta cgtggccacc cgcaagggca tcgccacatt       840
     ggctgtggtg cttggcgcct ttgctgcctg ttggttgccc ttcactgtct actgcctcct       900
     gggagatgcc gactctcccc gtctctacac ctatcttacc ctgctcccag ccacctacaa       960
     ctccatgatc aaccctgtca tctacgcctt tcgcaaccaa gatgtgcaga aggtgctgtg      1020
     ggccatctgc tgctgctgtt ccacttccaa gattccattc cggtcccggt cccctagtga      1080
     tgtctagttt catcctggtg aacctgtggc tttgactact atagaactcc agagtgttag      1140
     gtccaccagg gcttaattcc aatccccagc tccacgccct taagacccag ctggttctgg      1200
     agttctagga cgttgggtgt tttaggatct tattcaagat tcctgcgggg ggcccacccc      1260
     agctgaccgc gtggctctag aatgttccag atggtcaggg tcccactcgg aaatgtctca      1320
     cagcccaagt ggtttgcagt tccagaaggc tgggaatttt acagtaccat tccaagtcct      1380
     tgatcttcct tcccagaaac ttgaccttga tcatgtcgct tttgaatttc gaagctccag      1440
     agtcagaggt taatcactta gttgcctaga tgagagaaag atttatctct atatatgtgg      1500
     acatacagag aaggtttatt tatttattta ttatttattt atttataaat ttgcttatgg      1560
     gtggtaaggg ggaaaaaaga gacctacacc tagaaatcta gctcatatca gggtatcctc      1620
     agcctccatg accccatttc tgacctcagt ttccgaaggg ggcgggatgg aaaaagagaa      1680
     accacgtatt ttgttatttt tgcttatttt ttatcagaga aatcatagaa accagagcct      1740
     cctccccagg cccgcactgc tcgggtttgc agggagaaca caccagcctc tggtttttta      1800
     tttttttaag aagccatcac ctgagcaacc gagaattcct ctgcgctgag gcccggcttc      1860
     cctctggtgg ccatttgggg gaattgcaaa ccgacaaggc agtcgggatt gtaaaatgca      1920
     cccccatctc tcactccagc ctggctttca gcgccacagc catggcctgg gggccaggcc      1980
     ttaccctgag gtgcccgaga ggaggcggga caagagccag tacccccacc cctctgccaa      2040
     tcgggttatg gcccccagtg cattcctgtt cagtccccaa ccctactcaa taaaaaaaaa      2100
     atggtttttt tgg                                                         2113
//