Dbfetch

ID   AK140194; SV 1; linear; mRNA; HTC; MUS; 4402 BP.
XX
AC   AK140194;
XX
DT   06-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 10)
XX
DE   Mus musculus adult male corpora quadrigemina cDNA, RIKEN full-length
DE   enriched library, clone:B230339C01 product:5-hydroxytryptamine (serotonin)
DE   receptor 1A, full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-4402
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (30-MAR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 42ea242d84caf257f822ec8220e43d10.
DR   Ensembl-Gn; ENSMUSG00000021721; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000022235; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=B230339C01
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4402
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /sex="male"
FT                   /dev_stage="adult"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="B230339C01"
FT                   /tissue_type="corpora quadrigemina"
FT                   /db_xref="taxon:10090"
FT   CDS             616..1881
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="5-hydroxytryptamine (serotonin) receptor 1A
FT                   (MGD|MGI:96273 GB|NM_008308, evidence: BLASTN, 99%,
FT                   match=4278)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q64264"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000610"
FT                   /db_xref="InterPro:IPR002231"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:96273"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q64264"
FT                   /protein_id="BAE24273.1"
FT                   /translation="MDMFSLGQGNNTTTSLEPFGTGGNDTGLSNVTFSYQVITSLLLGT
FT                   LIFCAVLGNACVVAAIALERSLQNVANYLIGSLAVTDLMVSVLVLPMAALYQVLNKWTL
FT                   GQVTCDLFIALDVLCCTSSILHLCAIALDRYWAITDPIDYVNKRTPRRAAALISLTWLI
FT                   GFLISIPPMLGWRTPEDRSNPNECTISKDHGYTIYSTFGAFYIPLLLMLVLYGRIFRAA
FT                   RFRIRKTVKKVEKKGAGTSFGTSSAPPPKKSLNGQPGSGDCRRSAENRAVGTPCANGAV
FT                   RQGEDDATLEVIEVHRVGNSKGHLPLPSESGATSYVPACLERKNERTAEAKRKMALARE
FT                   RKTVKTLGIIMGTFILCWLPFFIVALVLPFCESSCHMPELLGAIINWLGYSNSLLNPVI
FT                   YAYFNKDFQNAFKKIIKCKFCR"
XX
SQ   Sequence 4402 BP; 1080 A; 1072 C; 1103 G; 1147 T; 0 other;
     ggaggaaggg agactagctg tctgagcgac acacaggact aaagaaagag aggtgagaag        60
     gaaaggggaa ctggaaggga aggccagtgg gaggaagccg ggagaaggaa gctgggaaaa       120
     gagaagcaga ctggagaagg caggagagat ggagagacag agagaaggaa ctaggagatg       180
     agggtcatcg agtgacccgg gaggatgggg tttctggaat ccagagactt ctgagactat       240
     tagttactcg ggagagtccg gcccccacgc agccagttgg acagcgacaa agtgaaatgg       300
     acagcgcgag acagatatta cagccatctc tccagcaccc agagatttgg aagatgcttt       360
     cagcccaact acagtttcct agctggagcc tctgagcgct caggacccgc gggagccaag       420
     caagagagcg ccggtgagtg ctcctctcag atgccttcgc cagagcaagt aagaacttcc       480
     cgctccagtc tctagatccc ctcccttcga aactccccag aaaggaagga agaccctagg       540
     gggaggggcg agggagatcc ccttgcattt ctttttccct cccttccccc caccccagcg       600
     ggagtgcagg caggcatgga tatgttcagt cttggccagg gcaacaacac cacaacgtcc       660
     ctggagccct tcgggacagg cggcaacgat actggcctct ccaacgtgac cttcagctac       720
     caagtgatca cctctctttt gctggggacg ctcattttct gcgcggtgct cggcaatgcc       780
     tgcgtggttg ctgccatcgc cctggagcgc tcccttcaga atgttgccaa ctatctcatc       840
     ggctccttgg cggtcaccga tctcatggtg tcagtgctgg tgctgcccat ggctgctctg       900
     taccaggtgc tcaacaagtg gactctgggt caggtcacct gtgacctgtt tatcgccctg       960
     gatgtgctgt gctgcacttc gtccatcctg cacctgtgcg ccatcgcgct agacaggtac      1020
     tgggcaatca ccgaccctat agactacgtg aacaagagga cgccccggcg cgccgctgcg      1080
     ctgatctcgc tcacttggct cattggcttt ctcatctcca tcccgcctat gctgggctgg      1140
     cgcaccccgg aagaccgctc gaaccccaac gagtgcacca tcagcaagga ccacgggtac      1200
     accatctact ccactttcgg cgctttctat attccgctgc tgctcatgct ggtcctctat      1260
     gggcgcatct tcagagccgc gcgcttccga atccgcaaga cggtcaagaa ggtggaaaag      1320
     aagggagcgg gcaccagctt cggaacatcg tcggccccgc cccccaagaa gagcctgaat      1380
     ggtcagccag gtagtgggga ctgcaggcgc agtgctgaga acagggcggt ggggactccg      1440
     tgcgctaatg gggcggtgag acagggtgag gacgacgcca ccctggaggt gatcgaggtg      1500
     catcgagtgg gcaactccaa agggcacctt cctctgccca gcgaatcagg agctacctcc      1560
     tatgtccccg cctgcttgga gagaaaaaat gagcgcactg ctgaggcaaa gcgcaagatg      1620
     gccttggccc gtgagaggaa gacagtgaag acactgggca tcatcatggg caccttcatc      1680
     ctctgctggc tgcccttttt cattgtggcc ctggtcctac ctttctgtga gagcagttgc      1740
     cacatgcctg agttgttggg tgccataatt aactggctag gctactccaa ctccctgctc      1800
     aacccagtta tttatgctta tttcaacaaa gactttcaaa acgcttttaa gaagatcatc      1860
     aagtgcaagt tctgccgctg atgatgatga tggtggtggt agtggtggta atagtggtgg      1920
     tgatggagaa ggaagaagtg ggggaagagt gtagggctta caggaccctt cctgttcact      1980
     caatatcccc gccctggaag caacacctaa gaaaacttgc ttttcctaga acacgcagct      2040
     tcttagccca tggctttcag atcttctctc tctatctcat tttaagggga cagtgctttt      2100
     tgcagaaatc ttagagaacc cctagcatct gtttgtaaaa ttattggctc ggtctttggc      2160
     cctaggatca gttttgatag ttgcaataac ctcctctcta ttcgaaatcc caattcttca      2220
     cgatggaagt ttaaacctcg gcgattcaag gaagaaaacc caaacagaaa atataaactg      2280
     tatggacatc taccatgccc actaggactg ccaccctctg ccctatatct ggaactttga      2340
     ggttcaagac tgctctgtct ctccctccct cttgctctag aaacatctgt tccctttggg      2400
     tgtcaatgta cactgctgat tctggtctcc atgcactcac ggctggtctg ggaaagttgg      2460
     aactactttg ggttatggtg ccctggaatt gtttgccttg ctgaatagca aaagatccct      2520
     ttccccaatg cacagcaccc actttctgta ttttgtttgt ttgtttgttt taactcaaaa      2580
     tcaagtgaca aagatgtctg ctggagtgga cttataagca agaagccagg cccaaaagga      2640
     agagccaaga aggcctgcgg atgttttcct gtcctggtgt cagcactcac caaagaaatt      2700
     gacaatcaga ctatttggaa ggaagagttt tattcctgta gtttgttggc ttttctgtaa      2760
     gttctggaaa ggccttgtgg actgcagaag gcgcccactg ctggccaggg agggctcatt      2820
     gagggtgctg agatgcccgg gatggctcac ctcaccctca gtttcttttc taggagtgag      2880
     ctatgccaga gcagctcacc ttgagtttgc agcctccggg ttcctccact cacctctcac      2940
     agtatcagga gctagtagag aagtttgagt ttgtgcaaga ggttggagac ttagaatttc      3000
     taaggaagtg tgggtgtgag gcacgtagag gaggtaagga gcaaaagggc tcctaagtgc      3060
     ttccaactcc tgcggcgtgc ccagggggtg ggggtgacct aaaggggcaa ttttaagcat      3120
     aggatgcaaa gtttctcaat ctaccccttc cccctttcaa ggaacagcat tgtgtagcat      3180
     ttcctaaaaa tgcccggatt tattctccgg gacattctgt gctcacacaa atttcgcaga      3240
     tctctgggct ctcattgtga agggtatcaa cacctcacca ttacctacct aggatcttga      3300
     tctcagagac ctaaaagaga gagcgatctc tgtggagtcc cagccaagtc agcccccaaa      3360
     ttctgagggt aaaaccagtt ttgtgtcctc tcaattttta aagcattttt ctccgctagg      3420
     ggttcttttc ctgctgttat ttttgctgtc ccacccccac ctcagagaag aaaattattt      3480
     aggtgcttcc tttgaatgta catttctagc taagtgagag ggcatcaaat ggttttgcgt      3540
     tatatctgaa cttcgaattt tctgttgaat aatggtttcc ttttcaagca attatacgga      3600
     gatttttttc accccccatc cccttcagct gtatctttcc aatgtctgca cctgctgttt      3660
     tgaaaacccg tgctgcattt ttttttaaat tgccaaagtt gctggtgaga tctccccctt      3720
     gtgtttataa acagggagaa aggactgccc tgccacatga agccattgtt tttatttgtt      3780
     aaactgagca aagtttcttt tgctctactc taaagtggga atgagtatta cagtcccttg      3840
     caacagagcc atttcagaat gtaagcctgt agggtgtcca cacctgagag actgacaggg      3900
     ggttctgtgg agaagacgca ctgggctggg cttctccagt acaaacagta cttgtttgta      3960
     aatttagctt gctttatttg tttgtttgtt tatttattta tcacaaaaat gaagtagaac      4020
     tatatggcca aataatattt ttctgtatgc tttactattt ttagaccaga tcatttactt      4080
     gaaataaaga tcatttactt gaaataaatc aatccctaaa tttcagatgt taaattggaa      4140
     accaagacct ctaacttcca gttctctgta tttttttttt tccaattagg aatgtttgac      4200
     cgtgatgggg gaggggcatt gctcttgtta ctttgagaaa gagactttaa acaagactgg      4260
     aaagggggca cccagctgga atataattgc caagtaatag agcaatcaga gaactaagtg      4320
     caacatgccg cacagctcta aagaacccct gatgcttgtt ttattttaaa atacttgtat      4380
     tacagtaaaa tgttaatgca tc                                               4402
//