spacer

EBI Dbfetch

ID   AK140160; SV 1; linear; mRNA; HTC; MUS; 1783 BP.
XX
AC   AK140160;
XX
DT   06-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 11)
XX
DE   Mus musculus adult male corpora quadrigemina cDNA, RIKEN full-length
DE   enriched library, clone:B230321G11 product:argininosuccinate lyase, full
DE   insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1783
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (30-MAR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; cb751b8b5dd912f77b04ecdc4bf7d904.
DR   Ensembl-Gn; ENSMUSG00000025533; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000159619; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=B230321G11
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1783
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /sex="male"
FT                   /dev_stage="adult"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="B230321G11"
FT                   /tissue_type="corpora quadrigemina"
FT                   /db_xref="taxon:10090"
FT   CDS             97..1491
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="argininosuccinate lyase (MGD|MGI:88084 GB|AK076453,
FT                   evidence: BLASTN, 99%, match=1537)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q91YI0"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR009049"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="InterPro:IPR029419"
FT                   /db_xref="MGI:MGI:88084"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q91YI0"
FT                   /protein_id="BAE24262.1"
FT                   /translation="MASESGKLWGGRFVGAVDPIMEKFNSSISYDRHLWNVDVQGSKAY
FT                   SRGLEKAGLLTKAEMQQILQGLDKVAEEWAQGTFKLHPNDEDIHTANERRLKELIGEAA
FT                   GKLHTGRSRNDQVVTDLRLWMRQTCSKLSALLRVLIGTMVDRAEAERDVLFPGYTHLQR
FT                   AQPIRWSHWILSHAVALTRDSERLLEVQKRINVLPLGSGAIAGNPLGVDRELLRAELNF
FT                   GAITLNSMDATSERDFVAEFLFWASLCMTHLSRMAEDLILYGTKEFSFVQLSDAYSTGS
FT                   SLMPQKKNPDSLELIRSKAGRVFGRCAGLLMTLKGLPSTYNKDLQEDKEAVFEVSDTMI
FT                   AVLQVATGVISTLQIHRENMKQALSPDMLATDLAYYLVRKGMPFRQAHEASGKAVFMAE
FT                   TKGVALNLLSLQELQTISPLFSGDVSHVWDYSHSVEQYSALGGTAKSSVEWQIRQVRAL
FT                   LQAQEP"
XX
SQ   Sequence 1783 BP; 468 A; 471 C; 513 G; 331 T; 0 other;
     gagaggggca gcggacgcca tccggaccag aaaaagccag gagagaccag aagattcgta        60
     agacagaagc tccaggagga ggaggaaccg cccaacatgg catcagagag cgggaagcta       120
     tggggtggcc ggtttgtggg tgctgtcgac cccatcatgg agaagttcaa ctcatctatc       180
     tcctatgacc ggcatctgtg gaatgtggat gtgcagggga gcaaggccta cagcaggggc       240
     ctggagaagg cggggcttct caccaaagcc gagatgcagc agatactgca agggttggac       300
     aaggttgctg aagagtgggc ccaaggcacc ttcaaattac atcctaatga tgaagacatc       360
     cacacagcca acgagcggcg cctgaaggaa ctcatcggtg aagctgcagg gaagctacac       420
     acaggacgaa gtcgcaacga ccaggtggtc acggacctca ggctgtggat gaggcagacc       480
     tgctcaaaac tctccgccct cctccgggtg ctcattggaa ccatggtcga ccgggcagag       540
     gcggaacgtg atgtcctctt cccagggtac acacacttgc agagagctca gcccattcgc       600
     tggagccact ggatcctgag ccacgctgtt gcgctgacac gagattcaga gagactcttg       660
     gaggtgcaga agcggatcaa tgtcttgcca ctggggagtg gggccattgc aggcaaccct       720
     ctgggtgtgg accgggagct actccgtgca gaactgaact ttggggccat cactctcaac       780
     agcatggatg ccaccagtga gagagacttt gtggctgagt tcctgttttg ggcttctctg       840
     tgtatgaccc acctcagcag gatggcagag gacctaattc tctatggtac caaggaattc       900
     agctttgtgc aactctcaga tgcctacagc accggaagca gcttgatgcc ccagaagaaa       960
     aacccagaca gcctggagct gatccggagc aaggcgggcc gagtgtttgg acggtgtgcc      1020
     ggactcctga tgaccctcaa gggacttcca agcacctaca acaaggactt acaggaagac      1080
     aaggaggctg tgtttgaagt gtctgacacc atgatagctg tcctccaagt ggccactgga      1140
     gtcatctcta cattgcagat tcatcgtgag aacatgaaac aggcgctcag ccctgacatg      1200
     ctggccacgg acctcgccta ctacctggtc cgcaaaggga tgccattccg ccaggcccac      1260
     gaggcctcag ggaaagctgt gttcatggca gagactaaag gagtggctct caacctgctg      1320
     tcgctacagg agctgcagac catcagtccc ctgttctcag gtgatgtgag tcacgtgtgg      1380
     gactacagtc acagcgtgga acagtacagt gccttgggtg gcacagcgaa atccagtgtc      1440
     gaatggcaga tcaggcaggt gcgggcccta ctgcaagccc aggagcccta gatcccgccc      1500
     acccaaagct gctccccaat aaagtggagc cctgaagaaa ccgagacaag catatgcttc      1560
     tgcctgtggt cctcatgagt gggctggggg atttgttgag ctggccaatg gggtcatgaa      1620
     ggaagtagaa aaaaacaaaa caaaacgaat gccaatgcaa agagagacag gaacaagggt      1680
     ttttcctcct acaccttaaa tcccagaccc ccaccccccg ccttgcaggt agcataactg      1740
     tgaatgcaag attaacacaa aatcataaac ttaaaacatc ctg                        1783
//


spacer
spacer