Dbfetch

ID   AK139476; SV 1; linear; mRNA; HTC; MUS; 2637 BP.
XX
AC   AK139476;
XX
DT   06-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 11)
XX
DE   Mus musculus 10 days neonate cortex cDNA, RIKEN full-length enriched
DE   library, clone:A830096P17 product:calpain 5, full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2637
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (30-MAR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 7f82f1cbf3ce55981692da283089d823.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=A830096P17
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2637
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /dev_stage="10 days neonate"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="A830096P17"
FT                   /tissue_type="cortex"
FT                   /db_xref="taxon:10090"
FT   CDS             <1..333
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="calpain 5 (MGD|MGI:1100859 GB|NM_007602, evidence:
FT                   BLASTN, 99%, match=2637)"
FT                   /note="putative"
FT                   /note="start codon is not identified"
FT                   /db_xref="InterPro:IPR000008"
FT                   /db_xref="MGI:MGI:1100859"
FT                   /db_xref="UniProtKB/TrEMBL:Q3UTF3"
FT                   /protein_id="BAE24027.1"
FT                   /translation="DSPTGANSYVIIKCEGEKVRSAVQRGTSTPEYNVKGIFYRKKLAQ
FT                   PITVQVWNHRVLKDEFLGQVHLKTAPDDLQDLHTLHLQDRSSRQPSDLPGIVAVRVLCS
FT                   ASLTAV"
FT   regulatory      2620..2625
FT                   /note="putative"
FT                   /regulatory_class="polyA_signal_sequence"
FT   polyA_site      2637
FT                   /note="putative"
XX
SQ   Sequence 2637 BP; 581 A; 762 C; 646 G; 648 T; 0 other;
     gactccccaa caggagcaaa ctcatatgtg atcatcaagt gtgagggcga aaaggttcgc        60
     tcagctgtgc agagagggac ctcgacacca gagtacaatg taaaaggcat cttctatcgc       120
     aagaagctgg ctcagcctat caccgtgcag gtttggaatc accgagtcct gaaggatgaa       180
     ttcctgggcc aggtgcacct gaagactgcc ccggatgacc tgcaggacct ccacaccctc       240
     catctccagg accgcagtag ccggcagccc agtgacctgc caggcattgt agctgtgcga       300
     gtcctctgca gtgcctctct cacggctgtc tgaccccagc ctgcctgtcc tgccccacta       360
     gtcctcacca ctactcgcat gtccccacct tgcctgggac cagcctggga accagacact       420
     ggggcccttt cctcactctt ccactgaccc actgtgtgac ctgaagagag ccctgccctc       480
     tctgagcctc agtgtttgga gggccccaaa gaattcccgt cttgtggggg agttttcttg       540
     cctaagattt aatgcagttc tctctaccca gtgggcgctg ctgttaaggg gccatctgct       600
     gaaaacgttt ccccaggccc tgctgtctgc caggagtgcc aagtgtcaac tgtttacaca       660
     caaactgcca tgtcccacgc cccttccctc tccttgtttg ctatggggga gattgcttcc       720
     ctccccagat ctttgctatg tagcttagag tgaccttaaa cttatgatcc ccctgcctcc       780
     acctcctcaa tgccgtacca ctataccagt ttgagtggtg ctgggtatgg aacccagggc       840
     tttgtgcatg ctaggcgagc acttaccaac tgagctacat ccccaatccc actacagccc       900
     attttaaaac catcttgaaa gaacccttat tggcatatgc aggagacatc tgctcattgt       960
     ctaatgcctg acccccattc atttagttat tcaatataga cttgcccaat tagcccatcg      1020
     agcctcccta ggcttcccga ttctcaggtc ttctcggagg cagatccctt cctgagctcc      1080
     aggctctgac ttcaccgtca ccctctgaag agctatgatc atgctggtga gaaagtatga      1140
     tttcccaacc tctgcttgtg gtgttggaag gagtggcctg gccaggcagg ttgatgtaag      1200
     gctatgggag acccaagggg aacacatgct gcctctgctg aaagaccctg ggtttttctt      1260
     ggaagaaagg actctagggt ggatggtacc aggccttcag ggttagatca tctgtcaagt      1320
     gtcaccgatg gggacttctc atgaccagag ggctctgcac cagcatcccc aaagagccaa      1380
     gaaggccacc atgcttttac tgtccagacc aaaatgttgc tctcaatccc caacatttga      1440
     tagtcttagc atttaaacaa aatctccgag tgagggaggc cagcccccac atttgtcctc      1500
     tgcaggctca ttttgttgag cgtctgcttt tatcttgaca ctgagcacga gagggcacgg      1560
     gtgggtgctc acagtgggac cttcttggag gaatctcaga gggggacaga gatgagatgt      1620
     gcattcctgg ctgccacctg cattcctgag gaactcttgt ttactggtgc tgtggctcac      1680
     aggtccccct ctgtgccatc cttcagcttc caggccagac ttagtagata aatagtaata      1740
     ataataataa tacaattgag ttatcagcca caattccttt tggaactgtt acactctgcc      1800
     tctggtccct ccaacgtggt cctcttcctg gctggaggtg ctggattctg actgccatct      1860
     tgctccatgg tggctcttct ggcctgggac ccggtccaca ggaagggcta ggagctgaat      1920
     taaagatgag agcatccctc ctgcacactg gggcttccct tcaccaggag caaatcactt      1980
     caacctcccg tgcctcgttt cctccctctg tagcatgggg ctcgagactc ctgtttgtga      2040
     gggactctta caaggataag agcaaggcca caccacttcc gctgtgtatc agtctatcat      2100
     acactccgca cggtcacatg atcacttcac ttctcgatgg ctattgcaga ccaagactgc      2160
     agtcaagaag ggagggtgag cctcacgatc ttgggtctca gggcctgaca taggggtctt      2220
     agctcagcca tatccctctg aggcacaggg cgagcaggga ccaagtagca gacgagtcga      2280
     tgcttcacct ggcatctagc cactgcctcc cacttctagc agaactgggt cagcagccct      2340
     gttcttgctt cctctctctt aagctaggcc aggctggctc ctggctgtga aggaacttcc      2400
     ggtccccaag aagccttgaa gactggacaa gggaggacag ggtggagcag ggatagccgt      2460
     ggcttcattt atcgtttgca cccaggaggc cttgtagtct tccaattgca ggagatcagc      2520
     cctacagtgt attctacgtg aaccaacagg gcctggcctt cactcctcca ggccacaatg      2580
     ccctggggtc aagggaaagg aactctgtta tcttctcaga ataaatatta ctgccgc         2637
//