Dbfetch

ID   AK139367; SV 1; linear; mRNA; HTC; MUS; 1783 BP.
XX
AC   AK139367;
XX
DT   06-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 11)
XX
DE   Mus musculus 10 days neonate cortex cDNA, RIKEN full-length enriched
DE   library, clone:A830030P14 product:G protein-coupled receptor 6, full insert
DE   sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1783
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (30-MAR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; e04afcd69b090f46ada3833d625d9a23.
DR   Ensembl-Gn; ENSMUSG00000046922; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000061796; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=A830030P14
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1783
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /dev_stage="10 days neonate"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="A830030P14"
FT                   /tissue_type="cortex"
FT                   /db_xref="taxon:10090"
FT   CDS             180..1271
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="G protein-coupled receptor 6 (MGD|MGI:2155249
FT                   GB|NM_199058, evidence: BLASTN, 99%, match=1092)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q6YNI2"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000723"
FT                   /db_xref="InterPro:IPR001151"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:2155249"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6YNI2"
FT                   /protein_id="BAE23977.1"
FT                   /translation="MNASAAALNESQVVAVAAEGAAAAATAAGAPDTGEWGPPAASAAL
FT                   GGGGGPNGSLELSSQLPAGPSGLLLSAVNPWDVLLCVSGTVIAGENALVVALIASTPAL
FT                   RTPMFVLVGSLATADLLAGCGLILHFVFQYVVPSETVSLLMVGFLVASFAASVSSLLAI
FT                   TVDRYLSLYNALTYYSRRTLLGVHLLLAATWTVSLGLGLLPVLGWNCLADRTSCSVVRP
FT                   LTRSHVALLSTSFFVVFGIMLHLYVRICQVVWRHAHQIALQQHCLAPPHLAATRKGVGT
FT                   LAVVLGTFGASWLPFAIYCVVGSQEDPAIYTYATLLPATYNSMINPIIYAFRNQEIQRA
FT                   LWLLFCGCFQSKVPFRSRSPSEV"
FT   regulatory      1764..1769
FT                   /note="putative"
FT                   /regulatory_class="polyA_signal_sequence"
FT   polyA_site      1783
FT                   /note="putative"
XX
SQ   Sequence 1783 BP; 362 A; 511 C; 489 G; 421 T; 0 other;
     gactcgcagc gaaggtggct cagcgacagg cgaccagtac tttcctcttt gacgcggggc        60
     agccttctgc aggcagctgc tcggaccgcg cagggaggat agccaggcac acagccgcgg       120
     agcgcatgac cagagactcc cgggatccct gactccccag ggagcaacat ctagcggcga       180
     tgaacgctag cgccgccgcg ctcaacgagt cccaagtggt ggcagtagcg gccgagggag       240
     cggcagctgc ggctacagca gcaggggcac cggacaccgg cgaatgggga cccccagcag       300
     catccgcagc gctgggaggc ggcggcggac ctaacgggtc actggagctg tcttctcagc       360
     tgccagcagg gccctcggga ctactgcttt cggcagtgaa tccctgggat gtgctgctgt       420
     gcgtgtcggg aactgtgatc gcaggcgaaa atgcgctggt ggtggcgctc atcgcgtcca       480
     ctcccgcgct gcgcacgccc atgtttgtgc tcgtgggtag tctggccact gctgacctgt       540
     tggcgggctg tggcctcatc ttacacttcg tgttccagta cgtggtgccc tcggagactg       600
     tgagcctgct catggtgggc ttcctggtgg cgtcctttgc cgcctcagtc agcagcctgc       660
     ttgctatcac agttgaccgt tacctgtctt tgtacaacgc gctcacctac tactcgcgcc       720
     ggaccctgtt gggcgtgcac ctcttgctag cagccacctg gacagtgtcc ctcgggttgg       780
     ggttgctgcc tgttctaggc tggaactgct tggccgaccg cacgtcctgc agcgtggtgc       840
     gccccctgac acgcagccat gtggcgttgc tctctacttc cttcttcgtg gtctttggca       900
     tcatgctgca cttgtacgtg cgcatctgcc aggtggtctg gcgccacgcc caccagatcg       960
     ctttgcaaca gcattgccta gcaccgcccc acttagcagc caccagaaag ggagtgggaa      1020
     ctttggccgt ggtgctaggc acttttgggg ccagctggct gcccttcgcc atctattgtg      1080
     tggtgggtag ccaagaggac ccggccatct acacttatgc caccctgttg cctgccacct      1140
     ataactccat gatcaatccc atcatctatg ccttccgcaa ccaggagatc cagcgtgcct      1200
     tgtggctcct gttctgtggc tgtttccaat ccaaagtgcc cttccgctcc aggtccccca      1260
     gtgaggtctg aagggctcct cgtgttccct cacaaacacc acaaacccaa catgccagcc      1320
     tttggtgagc gtcaaggtgc ctgctgatga actcttgagg tgtcagtggt gcaaatctga      1380
     ctctgctgga gcaaagggac tgaacgtgaa cgcaacgaac tgactcagac aaagaggctt      1440
     gttggcattt tacatataca gtgtatacat gtgtacatat atatacaaat ctttgtatct      1500
     tctgaggtgt tcaggacctg gagcttcctg ttctgtgaaa accaaacaaa atgtggttgt      1560
     atactcaatc gtacatcaca tttgtcaagt gaagacattc caatactgct taataatagc      1620
     actttatttt tagctgctga aatgccaaga cagtgttgcc atccccaaga gcaggagaaa      1680
     gggagtctaa gatgtatttt tgttgtatgt gatagagtat tttgctgcac atgcatcgta      1740
     aactacaaca tattttgtac acaaataaac acattataaa aat                        1783
//