spacer

EBI Dbfetch

ID   AK138964; SV 1; linear; mRNA; HTC; MUS; 2679 BP.
XX
AC   AK138964;
XX
DT   06-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 11)
XX
DE   Mus musculus adult male aorta and vein cDNA, RIKEN full-length enriched
DE   library, clone:A530031H21 product:frizzled homolog 6 (Drosophila), full
DE   insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2679
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (30-MAR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 34d98a03b1c17965ae8990cf72faaf46.
DR   Ensembl-Gn; ENSMUSG00000022297; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000022906; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000179165; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=A530031H21
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2679
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /sex="male"
FT                   /dev_stage="adult"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="A530031H21"
FT                   /tissue_type="aorta and vein"
FT                   /db_xref="taxon:10090"
FT   CDS             <1..1162
FT                   /codon_start=2
FT                   /transl_table=1
FT                   /note="frizzled homolog 6 (Drosophila) (MGD|MGI:108474
FT                   GB|AK088399, evidence: BLASTN, 100%, match=2678)"
FT                   /note="putative"
FT                   /note="start codon is not identified"
FT                   /db_xref="GOA:Q3UTZ0"
FT                   /db_xref="InterPro:IPR000539"
FT                   /db_xref="InterPro:IPR015526"
FT                   /db_xref="InterPro:IPR017981"
FT                   /db_xref="InterPro:IPR026543"
FT                   /db_xref="MGI:MGI:108474"
FT                   /db_xref="UniProtKB/TrEMBL:Q3UTZ0"
FT                   /protein_id="BAE23839.1"
FT                   /translation="AVWFHAVAWGAPGFLTVMLLAMNKVEGDNISGVCFVGLYDLDASR
FT                   YFVLLPLCLCVFVGLSLLLAGIISLNHVRQVIQHDGRNQEKLKKFMIRIGVFSGLYLVP
FT                   LVTLLGCYVYELVNRITWEMTWFSDHCHQYRIPCPYQANPKARPELALFMIKYLMTLIV
FT                   GISAVFWVGSKKTCTEWAGFFKRNRKRDPISESRRVLQESCEFFLKHNSKVKHKKKHGA
FT                   PGPHRLKVISKSMGTSTGATTNHGTSAMAIADHDYLGQETSTEVHTSPEASVKEGRADR
FT                   ANTPSAKDRDCGESAGPSSKLSGNRNGRESRAGGLKERSNGSEGAPSEGRVSPKSSVPE
FT                   TGLIDCSTSQAASSPEPTSLKGSTSLPVHSASRARKEQGAGSHSDA"
XX
SQ   Sequence 2679 BP; 682 A; 608 C; 628 G; 761 T; 0 other;
     tgcagtgtgg ttccatgccg ttgcctgggg ggcgcccggg ttcctgaccg tcatgctgct        60
     cgctatgaat aaggttgaag gagacaacat tagcggcgtt tgcttcgttg gcctgtatga       120
     cctggacgcc tctcgctact tcgtccttct gcctctgtgc ctctgcgtat ttgttgggct       180
     gtctctcctc ttagccggca tcatctcctt gaatcatgtc cgacaagtca tacagcatga       240
     tggccggaac caagagaagc taaagaaatt catgattcgc atcggagtct tcagtggcct       300
     gtatcttgtg cccttagtga cacttctcgg ttgctatgtc tatgagctag tgaacaggat       360
     cacctgggag atgacatggt tctctgatca ttgtcaccag taccgcatcc cgtgccctta       420
     ccaggcaaat ccaaaagctc gaccagaatt ggctttattt atgataaaat atctgatgac       480
     attaattgtt ggtatctctg cggtcttctg ggttggaagc aaaaagacgt gcacagaatg       540
     ggccgggttc tttaagcgaa accgcaagcg agaccccatc agtgagagcc gccgagtgct       600
     gcaagagtcc tgtgagttct tcctgaagca caactctaaa gtgaagcaca agaagaagca       660
     tggcgcacca gggcctcata ggctgaaggt catttccaag tccatgggaa ctagcacagg       720
     agcgaccaca aatcatggca cctctgccat ggcaatcgct gaccatgatt acttagggca       780
     agaaacttca acagaagtcc acacctcccc agaagcatcc gtcaaagagg gacgagcaga       840
     ccgagcaaac actcccagcg ccaaagatcg ggactgtggg gaatctgcag ggcccagttc       900
     caagctctct gggaaccgga acggcaggga aagccgagcg ggcggcctga aggagagaag       960
     caatggatca gagggggctc caagtgaagg aagggtaagt ccaaagagca gcgttcctga      1020
     gactggcctg atagactgca gcacttcaca ggccgccagt tctccagaac caaccagcct      1080
     caagggctcc acatctctgc ctgttcactc agcttccaga gctaggaaag agcagggtgc      1140
     tggcagccat tccgacgctt gaagaaaact gtctcgttcc cccagaagca catgtatgtt      1200
     acactggaga tgaccaactg atttgtctta taaaggccac tgttgagctg ggagagtagc      1260
     ccagtggtac agcgcccacc tggaatactt gaggacctgg ggttgtctcc cagcactgca      1320
     aaaggaaaat tcactgttac agtcttcctt gcacttaaac cagctttgtc tattgttttt      1380
     ttggtttggc ttttattttt gttgctgtta tttttgttgt tgtttgtttg tttttttgtt      1440
     tgtttgtttg agacagggtt tctttgctag ccctgactgt cctgaaactc cctctgtaga      1500
     ccaggctggc ctcaaactta cagagatctg cctgcctcag cctcccgagt gctgggaata      1560
     atggtgtggt caccactgcc cagccttttg tctgttttta aacttgaaag aaacaacagc      1620
     ccagatttca aaaataatat aatgcattta tacctaaaaa accaaccagg agtgcccagt      1680
     taataacact ttttaaatgt ggggatggga agggcattag aggagtcttc cttctattga      1740
     agattcatta aagtatttta agatatgctc tttcactctt tatataaatc caagattttt      1800
     ctttgctgaa gtatttaaaa cttttgtacc tttatatgta gatatgaatt tgaaaatatg      1860
     cttatgtgta tttgaacttt tgaaaatcct agagaattga atcaaatatt tttatgatgt      1920
     ttttctacta ttttagctac tttgcgactg tgatagctgt tacactggat ttttaaaaaa      1980
     cttgtacagc agcctcttta cagtaaaaag agtgggtgtc acactgaaag gtctgtaaga      2040
     agtggtcaca gccaccccta ccttccccaa aaggaggaac ttggtggcag gtccctccct      2100
     gattggactg tccctttctt tctgcatgtt ataaatcagc aggtaagatg gtaggttttt      2160
     acaagttagg ccgagctgtc gattcccctt ttaagtgttg aattaggatt gaattatggc      2220
     catttgtagt tgctcgtgcc tgtctttatt ttagtatttt atttcccgag acaggaactc      2280
     actgtgtggt gctccttggc tgtctggtgt tcagtctgtc ccaggcaggt cacagagatc      2340
     tccccctctg cagcccactc atctctccca agccaccaca ctcagctttt atctgtttta      2400
     aaaatttaaa cttaaaaaaa tgtttttgga atagtacaaa cacattgtgt tgtaaatttc      2460
     tttgatgcta tgcaaaattc ctatctgcat ctaagcctgc aaaagaaaat gtgcgaaggg      2520
     cagagtcaga gttgggcagg aagagtgtag tgcagcagat gcagcgtgaa gacactgaag      2580
     gtgctaagac agcgtctcag tgctggtcct ccttaaggat tatctcgcca gcgaggtttt      2640
     cttagatact ttgatcccat tggagctctg ttaaagttt                             2679
//


spacer
spacer