spacer

EBI Dbfetch

ID   AK138610; SV 1; linear; mRNA; HTC; MUS; 2892 BP.
XX
AC   AK138610;
XX
DT   06-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 14)
XX
DE   Mus musculus adult male spinal cord cDNA, RIKEN full-length enriched
DE   library, clone:A330074K17 product:UDP-Gal:betaGlcNAc beta
DE   1,4-galactosyltransferase, polypeptide 6, full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2892
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (30-MAR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   Ensembl-Gn; ENSMUSG00000056124; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000070080; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=A330074K17
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2892
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /sex="male"
FT                   /dev_stage="adult"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="A330074K17"
FT                   /tissue_type="spinal cord"
FT                   /db_xref="taxon:10090"
FT   CDS             920..2068
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="UDP-Gal:betaGlcNAc beta 1,4-galactosyltransferase,
FT                   polypeptide 6 (MGD|MGI:1928380 GB|NM_019737, evidence:
FT                   BLASTN, 99%, match=2892)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q3UUA9"
FT                   /db_xref="InterPro:IPR003859"
FT                   /db_xref="InterPro:IPR027791"
FT                   /db_xref="InterPro:IPR027995"
FT                   /db_xref="MGI:MGI:1928380"
FT                   /db_xref="UniProtKB/TrEMBL:Q3UUA9"
FT                   /protein_id="BAE23718.1"
FT                   /translation="MSALKRMMRVSNRSLIAFIFFFSLSTSCLYFIYVAPGIANTYLFM
FT                   VQARGIMLRENVKTIGHMIRLYTNKNTTLNGTDYPEGNNTSDYLVQTTTYLPQNFTYLP
FT                   HLPCPEKLPYMRGFLSVNVSEISFDEVHQLFSKDSEIGPGGHWRPKDCKPRWKVAVLIP
FT                   FRNRHEHLPIFFLHLIPMLQKQRLEFAFYVIEQTGTQPFNRAMLFNVGFKEAMKDRAWD
FT                   CVIFHDVDHLPENDRNYYGCGEMPRHFAAKLDKYMYILPYKEFFGGVSGLTVEQFRKIN
FT                   GFPNAFWGWGGEDDDLWNRVHYAGYNVTRPEGDLGKYISIPHHHRGEVQFLGRYKLLRY
FT                   SKERQYIDGLNNLLYTPKILVDRLYTNISVNLMPELAPIEDY"
XX
SQ   Sequence 2892 BP; 625 A; 813 C; 751 G; 703 T; 0 other;
     gctcttggtt cctcttctcc gggcgcagcg ccgcctggcg agttgtggac cggcgggcgg        60
     agccttgcag gggtctcggg gcgcacaggg ctgtcgggat tgtcctcgtg ggtgtccgcg       120
     gtccgagatc gcctcgcgtc tgtcatcttt ttccttcgcc ctccgggccc cggccgtgcg       180
     catccgccgg gtagtccggg gtctgtgcgg gggcggcgcc gcctctccct cgggctccgc       240
     ggcgggaatg cggctgctgt ggccggctgg gcagcgggcg gcggcagcaa gcggaacccg       300
     ggcgcactcg ccgctggccg ggacgccgcc ctggcctgcg ctccgctccc gaggccgccg       360
     ttgcgctccg gggcccggcg cggaatgagg tgcaggccgc gcgacggcga gcgccccgct       420
     ccgcggcccc caggttcccc gcgaccgtcc gtgcctcgcg tgccccggtg cccactttag       480
     agcccccgca ctagcagcgt tcgccaaggc acaggcccgc agagcgcacg cgacccggac       540
     cgggtcccga tcgcggggac tcgcctcttg gacgccgccc cgagtgcggg gaccccggca       600
     cgctgcagcg cgcgggccgc actccgcatc gccgagctcc gccagcctgg cccgtggctt       660
     tggcctccac cgagcccggt ctcccggcct cccttcacgt ttctccgcat ccttccaaca       720
     cccttcccgc tgctccaccg cctcccattc attgcatccg tttctccttc ccggctcggt       780
     tcttctcccc acagcctccc cggccggacc ccgccacctt cttggggttc tccgtacatt       840
     catggaagtt tagggcctgg accgtggccc ggagtctggc ctgagagcgc agcccgcgct       900
     actggcaggg cagaggaaga tgtctgcgct caagcggatg atgcgggtct ccaatcgctc       960
     tctgattgcc ttcatcttct tcttctccct ctccacgtcc tgtctctact tcatctatgt      1020
     ggctccaggc atcgccaaca cgtacctctt tatggtacaa gctagaggta tcatgctgag      1080
     agagaatgtg aaaacaattg gacacatgat caggctgtat accaataaaa acactacgct      1140
     caacggaaca gattatcctg aaggcaataa tacaagtgac tatcttgttc aaacaacaac      1200
     gtatcttccg caaaacttca cgtatttgcc acacctcccc tgtccagaga agctgcctta      1260
     catgcgggga ttcctcagtg tcaatgtgag tgagatcagt tttgatgaag tccatcagct      1320
     cttctccaag gactcagaga ttgggccagg aggccactgg aggcccaaag actgcaagcc      1380
     cagatggaag gtggcagttc tcatcccctt ccgtaaccgc catgaacatc ttccgatttt      1440
     tttcctgcac ctgattccga tgctccagaa acagcggctg gaatttgcct tttatgtcat      1500
     cgaacagacc ggcacacaac cattcaatcg tgcgatgctc tttaatgtgg gtttcaaaga      1560
     ggccatgaaa gacagagcct gggactgtgt gatcttccat gatgtggatc atctgcctga      1620
     aaatgatcgg aactactacg gatgtggaga gatgccgcgg cactttgcag cgaagctgga      1680
     caagtacatg tacattcttc cctataagga gttttttggt ggggtgagtg gcctgacggt      1740
     ggagcaattc aggaagatca acggctttcc caatgccttc tggggatggg gaggcgagga      1800
     cgatgacctt tggaacagag ttcactacgc cggctacaat gtaacccggc cagaagggga      1860
     cttgggaaaa tacatatcta ttcctcatca ccatcgaggg gaggtacagt tcctaggacg      1920
     gtataaatta cttcggtatt ccaaggagcg gcagtacatc gatggactga acaatttatt      1980
     atacacaccc aaaatactgg ttgataggct gtatacaaat atatctgtaa acctcatgcc      2040
     agaattagct ccaattgaag actattaaaa gaagtcattc tcatggtggg gtagaccaca      2100
     gtgctggatc atgaacttgg cttggagtgc cctcaccgtg gaagttagag attggggtgt      2160
     atctcagtgt cccggtctgt aaaaagagcc agcaatcctt aatgtttaca gcgcgggctc      2220
     catccgtcac actctcccac tctccccctg ctgggagcgt ccccccatgg caagcactgt      2280
     agagataaga acccattgct tgggactgga agtgaagaaa actccctaca cagagaagat      2340
     ttttatactg aaatctataa tttaattcaa gagaatgctt ttatttccgt tcaaacatat      2400
     tttgtacata tgtgatgtaa attaaatgtg ttcaaattgt tggaaaacaa gatgtcacaa      2460
     ttttgcatgt aattggttat gccttcattg gacttttata gacatttttt tatttgcatg      2520
     gggaaaaatg taaatttatg tcgccaaaca aaggttaagc cttgtgtcaa atgaagggac      2580
     tgtcagcgac agacaaagat aatatagtaa ccgttctgta ctattggtgt tcagctttag      2640
     accttcagcc tcatggcagg aggcacggtc ctctgagggc ttcgaaggaa ggaaggactc      2700
     gcataacttt tcttcctgcc acgattacct gttttgtttt gtctattttt tcccttgctt      2760
     gcagtctcat cagatcttgc caagtcaaca gccatattgt ttatgcatac tgcatgagta      2820
     ttaccaagaa aaccttccca gttgtaaagt gacgtgctgt acaggacttc ttcatgttaa      2880
     atgtctctat gt                                                          2892
//


spacer
spacer