Dbfetch

ID   AK138275; SV 1; linear; mRNA; HTC; MUS; 3725 BP.
XX
AC   AK138275;
XX
DT   06-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 11)
XX
DE   Mus musculus adult male hypothalamus cDNA, RIKEN full-length enriched
DE   library, clone:A230053G01 product:calcitonin receptor, full insert
DE   sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-3725
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (30-MAR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; ec9772613353c361f705da9d92835167.
DR   Ensembl-Gn; ENSMUSG00000023964; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0030422; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0030395; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0030322; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0030404; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0030118; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0030859; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0029519; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0030096; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0030240; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0030194; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0030327; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0030230; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0030889; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0029234; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0029596; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000075644; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000115622; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000168592; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000170266; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000171613; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0076140; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0076217; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0076122; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0076157; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0075780; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0076631; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0076328; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0075743; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0075892; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0075784; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0075941; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0075806; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0076866; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0075781; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0074911; mus_musculus_wsbeij.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=A230053G01
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3725
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /sex="male"
FT                   /dev_stage="adult"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="A230053G01"
FT                   /tissue_type="hypothalamus"
FT                   /db_xref="taxon:10090"
FT   CDS             557..2047
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="calcitonin receptor (MGD|MGI:101950 GB|AK039161,
FT                   evidence: BLASTN, 99%, match=2454)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q60755"
FT                   /db_xref="InterPro:IPR000832"
FT                   /db_xref="InterPro:IPR001688"
FT                   /db_xref="InterPro:IPR001879"
FT                   /db_xref="InterPro:IPR003287"
FT                   /db_xref="InterPro:IPR017981"
FT                   /db_xref="InterPro:IPR017983"
FT                   /db_xref="MGI:MGI:101950"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q60755"
FT                   /protein_id="BAE23606.1"
FT                   /translation="MTPRRSRVKRRNLRKPKMRFLLVNRFTLLLLLLVSPTPVLQAPTN
FT                   LTDSGLDQEPFLYLVGRKKLLDAQYKCYDRIHQLPSYEGEGLYCNRTWDGWMCWDDTPA
FT                   GATAYQHCPDYFPDFDTAEKVSKYCDENGEWFRHPDSNRTWSNYTLCNAFTSEKLQNAY
FT                   VLYYLALVGHSLSIAALVASMLIFWIFKNLSCQRVTLHKHMFLTYILNSIIIIIHLVEV
FT                   VPNGDLVRRDPISCKVLHFLHQYMMSCNYFWMLCEGIYLHTLIVMAVFTDEQRLRWYYL
FT                   LGWGFPIVPTIIHAITRALYYNDNCWLSAETHLLYIIHGPVMVALVVNFFFLLNIVRVL
FT                   VTKMRQTHEAESYMYLKAVKATMVLVPLLGIQFVVFPWRPSNKVLGKIYDYLMHSLIHF
FT                   QGFFVATIYCFCNHEVQVTLKRQWTQFKIQWSQRWGRRRRPTNRVVSAPRAVAFAEPDG
FT                   LPIYICHQEPRNPPISNNEGEESTEMIPMNVIQQDASA"
FT   regulatory      3699..3704
FT                   /note="putative"
FT                   /regulatory_class="polyA_signal_sequence"
FT   polyA_site      3725
FT                   /note="putative"
XX
SQ   Sequence 3725 BP; 967 A; 904 C; 817 G; 1036 T; 1 other;
     ggtgttagtc acctcgaggg ctacagccac tttgcattcc cgggatacac aggtaactgc        60
     ttttcctggc ttttgcttga acagtcagga aaagaagtgc ccgctgatgc ctggctgcac       120
     ccagctccgg ataggaggtg gaggatagcc cgtccttgga agcaacttgc tttcctccca       180
     gggtgcgcct gccagcccag actgcgcccg cctggaatca gattgtcccg ggctcctgct       240
     ggctttcagt ggagaagggg aattgtcctc aacaccaagt caggagagcc agccgcccaa       300
     gactctgggc ggactgcacc tggctggctt gcagacaact cttggttgga gaggtgctta       360
     cttctgcgcc tcaccctgcc gttggcatcc ccctgcctgc agatgcccag tgaagtctgc       420
     gttcctgaga acacctgagc tgtgcccaga catccagcaa gagaattcct gcatccacct       480
     aaggtaagtg ccattagagc gccttccaga ggagaagaaa ccgagggagc agggctacta       540
     cacagaggat ttgaaaatga ctccaaggag gtccagagtg aaaaggcgga atctccgcaa       600
     accgaagatg aggttccttc tcgtgaacag gttcaccctg ctgctcctgc tcctagtgag       660
     cccaactcca gttcttcagg ctcctaccaa tctcactgac tccggccttg atcaggagcc       720
     attcctgtac ttggttggcc gcaagaagct gctggatgct cagtacaaat gctatgaccg       780
     gattcatcag ttgccctctt atgaaggaga aggtctgtac tgcaaccgca cctgggatgg       840
     ctggatgtgc tgggacgaca ctcccgctgg agccacagcc tatcagcact gccctgacta       900
     cttcccggac tttgacacag cagaaaaggt ttcaaaatac tgtgatgaaa atggagagtg       960
     gtttagacac cctgacagca accgaacctg gtccaactat actctgtgca acgctttcac      1020
     ttctgagaaa ctgcaaaatg cgtacgttct ttattacctg gctcttgtgg gtcactcctt      1080
     gtcgattgct gctttggttg cttccatgct gatcttctgg attttcaaga accttagctg      1140
     ccagagggtg accttgcaca agcacatgtt ccttacttat attctgaatt ctatcattat      1200
     catcatccac ctggttgagg ttgtgcccaa tggagatctg gtgcggcggg atcctataag      1260
     ttgcaaggtt ctacactttt tacatcagta catgatgtct tgcaactact tctggatgct      1320
     ctgcgagggg atctatcttc atactctgat tgtcatggct gtgtttaccg acgagcaacg      1380
     cctacgctgg tactatcttc ttggctgggg gttcccgata gtgccaacca ttatccacgc      1440
     catcactcgt gccctctact acaacgacaa ctgctggctg agtgcagaaa cccacttgct      1500
     ttacatcatc catggacccg tcatggtggc tctggtggtc aacttcttct ttcttctcaa      1560
     cattgtccgc gtgcttgtga ccaagatgag gcaaacccac gaggccgagt cctacatgta      1620
     cctgaaggct gtgaaggcca ccatggtcct tgtgcccctg ctggggatcc agtttgttgt      1680
     gtttccctgg aggccctcca acaaggtgct tgggaagatc tatgattatc tcatgcactc      1740
     tctgattcat ttccagggat tctttgtggc gactatctac tgcttctgca accatgaggt      1800
     gcaagtcacc ctgaagcgcc agtggacgca gttcaagatc cagtggagcc aacgctgggg      1860
     aaggcgccgc cgccccacca accgcgtagt tagtgctcct cgggctgtag ccttcgctga      1920
     gccagatggc ctccccattt acatctgcca tcaggaacca cggaatcctc caatcagcaa      1980
     caacgaaggc gaggagagta ctgaaatgat ccccatgaac gtcatccagc aagacgcatc      2040
     cgcttgaatg tgaagccacc ccaagcattg tgatccactg agccttcatt tcctggggaa      2100
     agacagacca tgtgtttcaa gtgattccca tcctcccagg agctgaccat atcatttgtg      2160
     aagaagtgtt aagtgaattt gtccatagtg aatttgaaga aagtgattct tggtactatt      2220
     gctttgggag tcagtctagg aatagagtct cccattgcaa cttgtgaact ccatcattca      2280
     tcctggactg agatgactgt gttcgtagga aagcaggcaa ggtgttcaaa agatgtcaca      2340
     ctattgacct agttcagata cagggtgctc cttgtgaatt ttgagccatt tgtaccgttg      2400
     agaaattaaa atcactctca atgtttttaa atttgacact ggattttgaa ttagactatt      2460
     tctgtatttg actacagatc tggtttttaa tgtttttatt tcagtcagtt cctatattac      2520
     acatgttacc atccatacaa tgtcaactac acatatagca tgacctctga aagatggtgt      2580
     gtcttttata acatgatcca gttcaccagg cagacccaaa tgctgtaatg aattgatctg      2640
     aaccttgtat gtgctttggt cactgacatt tataagttgg gaggtcacca agaacctatc      2700
     accaaattta tcacaaaact gccctccaaa atgtaacaat ctttaaagag agttttccac      2760
     tttcctaaac tacaggattt ataaaacaaa tcactccaag gtttataaag cagattacct      2820
     cttgcccttg ggtgctatct agcagtaaga gaaagatttg tttacgactg gtaattaaaa      2880
     gactccatac aagtccatta actgccttcc acccagcttc aaagctaaac aagatcccct      2940
     gtgtttttca agaagactct gtgtggctaa ttacaaatca gtttcttgtt gacctcttgc      3000
     ttgctgctat tagcaaaaca agagggggaa aaacccacaa tgtagggact tcaaatttaa      3060
     cctcatatta attcatctta aattaaaaac agagcttctc atccaaaccc agtactatat      3120
     ctccataccc ctctttactc cccagtagga gatcatctaa gatccatgaa taaaccaata      3180
     ccatcacaga tttctgaatc tgcaacagta accagtcatc attacttaat ttgtatgcta      3240
     aatgaggagc ttttttgaga ccctcaaaat ctcctctcac ctttgtaatc ttttgtcact      3300
     gcctttcaga ggtgatttag ttgtgtaaag acaaaagtaa cttgatttgt tctggttaca      3360
     tgcttggtgt acccagagaa aactgtattt caatagcaac tgtggacctt ggatactgag      3420
     agttgccttt accaaaatgg aaggacggat tgaaggaagg atgttttttc aatcacagtg      3480
     ttacctggtg atgtccctat gttttgttta cacacatcga aatcagtgta tttcaggcag      3540
     ctctagtaca aatgtgataa tatattgaag tgtttgagat gttattgtgc ttatgtagta      3600
     ggagctgatg aaatcaaact gacttaccat aacattgcat gtcataccta aattgtgtga      3660
     aacgcttctg ctgtgtacat gtataaatac agaggcatat taaaaaggca aagagtngta      3720
     tattg                                                                  3725
//