Dbfetch

ID   AK138150; SV 1; linear; mRNA; HTC; MUS; 2880 BP.
XX
AC   AK138150;
XX
DT   06-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 11)
XX
DE   Mus musculus adult male hypothalamus cDNA, RIKEN full-length enriched
DE   library, clone:A230015K19 product:5-hydroxytryptamine (serotonin) receptor
DE   7, full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2880
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (30-MAR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 324a55ae62a4dadab782739f6052ead1.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=A230015K19
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2880
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /sex="male"
FT                   /dev_stage="adult"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="A230015K19"
FT                   /tissue_type="hypothalamus"
FT                   /db_xref="taxon:10090"
FT   CDS             <1..1256
FT                   /codon_start=3
FT                   /transl_table=1
FT                   /note="5-hydroxytryptamine (serotonin) receptor 7
FT                   (MGD|MGI:99841 GB|NM_008315, evidence: BLASTN, 99%,
FT                   match=1340)"
FT                   /note="putative"
FT                   /note="start codon is not identified"
FT                   /db_xref="GOA:Q3UUR3"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR001069"
FT                   /db_xref="InterPro:IPR002231"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:99841"
FT                   /db_xref="UniProtKB/TrEMBL:Q3UUR3"
FT                   /protein_id="BAE23561.1"
FT                   /translation="SPDGGAHSVVSSWMPHLLSGFPEVTASPAPTWDAPPDNVSGCGEQ
FT                   INYGRVEKVVIGSILTLITLLTIAGNCLVVISVCFVKKLRQPSNYLIVSLALADLSVAV
FT                   AVMPFVSVTDLIGGKWIFGHFFCNVFIAMDVMCCTASIMTLCVISIDRYLGITRPLTYP
FT                   VRQNGKCMAKMILSVWLLSASITLPPLFGWAQNVNDDKVCLISQDFGYTIYSTAVAFYI
FT                   PMSVMLFMYYQIYKAARKSAAKHKFSGFPRVQPESVISLNGVVKLQKEVEECANLSRLL
FT                   KHERKNISIFKREQKAATTLGIIVGAFTVCWLPFFLLSTARPFICGTSCSCIPLWVERT
FT                   CLWLGYANSLINPFIYAFFNRDLRTTYRSLLQCQYRNINRKLSAAGMHEALKLAERPER
FT                   SEFVLQNCDHCGKKGHDT"
FT   regulatory      2854..2859
FT                   /note="putative"
FT                   /regulatory_class="polyA_signal_sequence"
FT   polyA_site      2880
FT                   /note="putative"
XX
SQ   Sequence 2880 BP; 741 A; 659 C; 716 G; 764 T; 0 other;
     ggagccccga cggtggcgcc cactcggtgg tgagctcctg gatgccgcac ctgctgagcg        60
     gcttcccaga ggtgacagct agcccggcgc ccacctggga cgcgcccccg gacaatgtct       120
     ccggctgcgg ggagcagatc aactatggca gagtcgagaa agttgtgatc ggctccatcc       180
     tgacgctcat cacgctgctg acgatcgcgg gcaactgcct ggtggtgatc tcggtgtgct       240
     ttgtcaagaa gctccgccag ccctccaact acctgattgt gtccctggcg ctggctgacc       300
     tctcggtggc cgtggcggtc atgcctttcg ttagtgtcac ggacctcatc gggggcaagt       360
     ggatcttcgg ccacttcttc tgcaacgtct tcatcgccat ggacgtcatg tgctgcacgg       420
     cctcgatcat gaccctgtgc gtgatcagca tcgacaggta ccttgggatc accaggcccc       480
     tcacgtaccc cgtgaggcag aatgggaaat gtatggccaa aatgattctg tcggtctggc       540
     ttctctctgc ctccatcacc ttacctcctc tcttcggatg ggctcagaat gtgaacgatg       600
     acaaagtgtg cttgatcagc caggattttg gctacacgat ctactccacc gcagtggcgt       660
     tttatatccc catgtcggtc atgctgttca tgtactatca gatttacaag gccgccagga       720
     agagcgcagc caaacacaag ttctcaggct tcccacgcgt gcagccggag agcgtcatct       780
     ccctgaatgg cgtggtgaaa ctccagaagg aggtggaaga gtgtgcgaac ctttcgagac       840
     tgctcaaaca cgaaaggaaa aacatttcca tcttcaagag ggaacagaaa gcagccacta       900
     ccttggggat catcgtggga gccttcacgg tgtgctggct gccgtttttc ctcttgtcca       960
     cagcaaggcc ctttatctgt ggcacctcct gtagctgcat cccgctgtgg gtggagagga      1020
     catgtctgtg gctgggctat gcaaactctc tcattaaccc ttttatatat gccttcttca      1080
     accgggacct gaggaccacc tatcgtagcc tactccagtg ccagtaccgg aatatcaacc      1140
     ggaagctctc tgctgcaggc atgcacgaag ccctgaaact tgctgagagg cctgagagaa      1200
     gcgagtttgt gctacaaaac tgtgaccact gtgggaaaaa aggtcatgat acatgatcca      1260
     gagcggaacc ctggagaaga agtaatgcag aacaggggga aacaacgaaa ccattggctg      1320
     agactgcaca acagaacttg gcttctgtct tcttggcatg gctgaaatgt gacaaggggt      1380
     gatctgttgt acaaagtgta tcttgaggga gatggcaacc tctctctgtt tttttctgtg      1440
     gatcagtgat attgtgttta aatgaaaaaa aatgctcagt gtcagacagc cagtcatctc      1500
     tgcggtaagc acactacagc gctgggttct gggaggggag ggaagcagtt tctggtgctt      1560
     tccacaaatc cacatccatg agagtggggg gaaatcctaa cgcacaattc ccatgcttcc      1620
     cgtctaggct ttgtggtaac tcttcaggaa ccattcatga gacagagttc attttgtggt      1680
     ctatcagaag ggtgtctttc caagcaaact gcagtaagca tcgtgttgaa tgtgttgcat      1740
     gtccatgtta gaaaacagaa accagtcatc agcgaacaca agcgattccc cggagcagtg      1800
     ttcattcaaa gcttctgtta aatactgtgg cttttctgca gggtccttgt gactttccac      1860
     cagtgtatgt ccaccgttaa atcctttatc attatggtgt aactcaggaa cagatctcag      1920
     gatggagaga ggcagaaaac ctgaataaag cttttccttg tactcacact cctgaaggct      1980
     cctgagagag aatggtaact ggagaagagt gaatgccgca tcactgcatt gtatattaac      2040
     atgattcttg gcatgttgtt tactctcatc ttctacaagg gtacaaggag cccacggggc      2100
     tgctccataa tggtgtgtca tgagcaggga gtgtggcaat agcatatcca tgaatgattg      2160
     tggttgtttc tggagacagt ataaacatgg tcatccaact ggacctgttt gaattgtgtg      2220
     aattacctct cacttgaacc cccattgtta atactctgga acaccattct gtttcatgtg      2280
     gagaatttgt ctctgtgttc tctgtatctt aaatcaaatg tgtgcctgat gaattctgtc      2340
     ccttaactcc ctcccaccaa taaaaatggt caaagttaag gacagataag gaaacagaaa      2400
     ggtttttttt gtggatagta tcatttaaat gttactatgt agtagtctgg gtgaaggaga      2460
     gggaaaggca cagatcagaa gagtacccat gcctacaagg ggacatgaat gaaaaccttt      2520
     atttgataaa aagagaactg aaagagaata ttattttcct acagttaagg aggctgtcct      2580
     ttcacaggat aaaatagagt tacaaagtgg attatggact tcttccagat gtcactgatg      2640
     tttattatga gagcaggacc cctttcctgt ggaggggagg taggcactgt cctttcagac      2700
     aaagtgtgta caaattcctg agctgcagat tcgctagagt gaacgtatat acttatattc      2760
     ataatttaaa taacaattat gtcatataca tgttgttaaa tttgaaaaaa atgttttatt      2820
     acatcacatc aaataaaggt tatttgtagc tgtaataaag taacttaagt aattgttttt      2880
//