spacer

EBI Dbfetch

ID   AK137387; SV 1; linear; mRNA; HTC; MUS; 3512 BP.
XX
AC   AK137387;
XX
DT   06-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 11)
XX
DE   Mus musculus 16 days neonate cerebellum cDNA, RIKEN full-length enriched
DE   library, clone:9630042L14 product:solute carrier family 12, member 6, full
DE   insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-3512
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (30-MAR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; c26f54532a63add8da5030337eb91a26.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=9630042L14
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3512
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /dev_stage="16 days neonate"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="9630042L14"
FT                   /tissue_type="cerebellum"
FT                   /db_xref="taxon:10090"
FT   CDS             380..2713
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="putative"
FT                   /note="solute carrier family 12, member 6 (MGD|MGI:2135960
FT                   GB|NM_133648, evidence: BLASTN, 99%, match=2489)"
FT                   /db_xref="GOA:Q3UVD1"
FT                   /db_xref="InterPro:IPR000076"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="InterPro:IPR004842"
FT                   /db_xref="InterPro:IPR030364"
FT                   /db_xref="UniProtKB/TrEMBL:Q3UVD1"
FT                   /protein_id="BAE23339.1"
FT                   /translation="MGTFMGVYLPCLQNIFGVILFLRLTWVVGTAGILQAFAIVLICCC
FT                   CTMLTAISMSAIATNGVVPAGGSYFMISRALGPEFGGAVGLCFYLGTTFAAAMYILGAI
FT                   EIFLVYIVPRAAIFRSDDALKESAAMLNNMRVYGTAFLVLMVLVVFIGVRYVNKFASLF
FT                   LACVIVSILAIYAGAIKSSFAPPHFPVCMLGNRTLSSRHLDICSKTKEVDNMTVPSKLW
FT                   GFFCNSSQFFNATCDEYFVHNNVISIQGIPGLASGIITENLWSNYLPKGEIIEKPSAKS
FT                   SDVLGNLNHEYVLADITTSFTLLVGIFFPSVTGIMAGSNRSGDLKDAQKSIPIGTILAI
FT                   LTTSFVYLSNVVLFGACIEGVVLRDKFGDAVKGNLVVGTLSWPSPWVIVIGSFFSTCGA
FT                   GLQSLTGAPRLLQAIAKDNIIPFLRVFGHSKANGEPTWALLLTAAIAELGILIASLDLV
FT                   APILSMFFLMCYLFVNLACALQTLLRTPNWRPRFRYYHWALSFMGMSICLALMFISSWY
FT                   YAIVAMVIAGMIYKYIEYQGAEKEWGDGIRGLSLSAARFALLRLEEGPPHTKNWRPQLL
FT                   VLLKLDEDLHVKHPRLLTFASQLKAGKGLTIVGSVIVGNFLENYGDALAAEQTIKHLME
FT                   AEKVKGFCQLVVAAKLKEGISHLIQSCGLGGMKHNTVVMGWPNGWRQSEDARAWKTFIG
FT                   TVRVTTAAHLALLVAKNVSFFPSNVEQFSEGNIDVWWIVHDGGMLMLLPFLLKQHKVFW
FT                   VTTLPLAVMVGLNLKRQGLFLAVP"
XX
SQ   Sequence 3512 BP; 863 A; 852 C; 817 G; 980 T; 0 other;
     aagatttagc tcccgagaaa gtgtgccaga aacaagccgt agtgagccta tgagcgaact        60
     gtctggggct actacttctc tggcaactgt tgccctagat ccttccagtg accggacttc       120
     taatccccag gatgttacgg aggatgacgg ccataaaaaa gcccgaaatg cttatctcaa       180
     taattccaac tatgaagaag gagacgaata ttttgataaa aatttggcac tctttgagga       240
     agaaatggac accagaccaa aggtgtcttc tctcctcaac cgcatggcca actaaacaaa       300
     tctgacacaa ggagcaaagg aacatgaaga ggcagagaac atcactgaag ggaaaaagaa       360
     gcctaccaag agcccccaaa tgggtacttt catgggtgtc tacctcccat gtctacagaa       420
     catctttgga gtgatcctct tcctgcgtct tacctgggta gtgggaacag ctggaatcct       480
     tcaggccttt gcaattgtcc tcatctgctg ctgctgtaca atgttaactg ccatctccat       540
     gagcgccatc gccactaacg gagtggtgcc agctgggggc tcatacttca tgatttccag       600
     agccctgggc ccagagtttg gcggggctgt aggcctctgc ttttatcttg gcaccacatt       660
     tgcagcagcc atgtatattc ttggtgccat tgaaatcttt ctggtataca ttgtcccccg       720
     agctgccatc tttcggagtg acgatgcact caaggagtca gcagctatgc tgaacaacat       780
     gcgcgtctat ggtacagcct tcttggtcct catggtcttg gtggtattca tcggcgtacg       840
     ctatgtgaat aagtttgcct cactcttcct ggcctgtgta attgtgtcga tcttggctat       900
     ctatgctggt gccatcaagt cttcctttgc tccaccacac ttcccggtct gtatgctggg       960
     caaccgtacc ctgtcatcaa gacaccttga catttgctct aagaccaagg aggttgacaa      1020
     catgacagta ccatcaaagt tatggggatt cttctgcaac tcgagtcagt tctttaatgc      1080
     cacctgtgat gagtactttg ttcacaataa cgtcatctca atccaaggca ttccagggtt      1140
     ggctagtggt atcattactg aaaatctttg gagtaattat ttaccaaagg gtgagataat      1200
     tgaaaagcca tcagccaagt catctgatgt cttaggcaac ttaaaccatg aatatgttct      1260
     tgctgatatc accacctcct tcactctgct ggtggggatc ttctttccct cggtcacagg      1320
     tatcatggct gggtcaaaca gatctggaga tctgaaagat gcccagaagt ctattcccat      1380
     tgggaccatc cttgccatcc tgaccacatc ctttgtgtat ttaagcaatg ttgtcctttt      1440
     tggtgcatgt attgaaggag tcgttctcag agacaaattt ggggatgctg taaaagggaa      1500
     tttggttgta ggcaccttat cctggccatc cccgtgggtg atcgttattg gctccttctt      1560
     ttcaacatgt ggggctgggc tgcagagcct cacaggtgcg cctcggctgc tgcaggctat      1620
     cgccaaggat aacatcatac ctttccttag ggtttttggt cacagcaaag ctaatgggga      1680
     acctacctgg gctttacttc taactgctgc catagcagag ctgggaattc tcatcgcctc      1740
     cctggatctc gtggccccaa ttctttccat gttttttctc atgtgttacc tctttgtgaa      1800
     cttggcttgt gccttgcaaa cattgctgcg aacccccaac tggaggcctc gattccgcta      1860
     ttatcactgg gccctctctt tcatgggaat gagtatctgt ctagctctga tgttcatttc      1920
     ttcttggtat tatgccattg tagctatggt aatagctggc atgatctaca agtacattga      1980
     atatcaaggg gctgagaaag aatgggggga tggtatccgt gggctgtcgc tcagtgcagc      2040
     ccgcttcgct ttgctccgtc tagaggaagg acctcctcac actaaaaact ggaggcctca      2100
     gctgctcgtc ctactgaagc tggatgaaga tttacacgtc aagcaccctc gcctcctcac      2160
     ctttgcctcc cagctcaagg caggaaaggg actcacgatt gtgggctctg tcatcgtggg      2220
     gaacttcttg gagaactatg gtgacgcgct cgcggcagag cagaccatta agcacctaat      2280
     ggaggcagaa aaggtaaaag gattctgcca attggtggtg gctgccaagc tgaaagaggg      2340
     catttcacac ctcatccagt cctgtggcct cggaggcatg aaacacaaca cagtggtgat      2400
     gggctggccc aatggctggc gtcagagtga agatgctcgc gcttggaaga ctttcattgg      2460
     cacagtacga gtgacaactg ctgcccatct agccctgctg gtggctaaaa atgtctcctt      2520
     ctttcccagc aatgtggagc agttttctga gggcaacatt gatgtgtggt ggattgtgca      2580
     tgatgggggc atgctcatgc tattaccgtt cctgctgaaa cagcacaagg tattctgggt      2640
     caccacttta cctcttgctg taatggtggg acttaatctg aagagacagg gcttgttctt      2700
     ggctgtccca taatcccagc tccagcctta tgagaagtag agtgggttta aggttttatt      2760
     ttttaatttt acttgttgtt atattttata ccagtcctcc ttaagtgaat tcctgcaagc      2820
     ttactaaaat tcctgtataa tagtgtttag aaaaaacaaa aaacagagaa accaaataca      2880
     agggtacatc agtttcaggt gcagtcctca ctgctctgga actcgctctg tacaccaggc      2940
     tgcccttgaa ctcagagatc caccagcctt tacctcctga gttctaggat tggagatatg      3000
     tgccaccata cccagctctc tattaaattt gtaatggtat cattgctatg ctgtttgaat      3060
     aaaccactca gtgtaccctg agtgcggata tgtttttccc tccccatatg aagccagcag      3120
     ctgttctgca gtgggcagca gtttggtgtc ctctaaatca atactgacat aattatctgt      3180
     aggtagcact ccatccattt taaactgata gtcttacact gtcttcctgc aagccctgat      3240
     tattctaccc ctgctctgac ttaggagacc aatttcacaa taccatatga gcaaattttt      3300
     tcttggtaat gaaattaaga acttaaaacc aggaataatc gggcagtagt ggtgcacgcc      3360
     tttaatccca gcactcggga gacatcggat ttctgagttc ggggccagcc tgctctacag      3420
     agtgagattt ctgagttcga ggccagcctg ctctacagag tgagttccag gacagccagg      3480
     acaacaaaga gaaaccctgt ctcaaaaaaa cc                                    3512
//


spacer
spacer