spacer

EBI Dbfetch

ID   AK137385; SV 1; linear; mRNA; HTC; MUS; 4382 BP.
XX
AC   AK137385;
XX
DT   06-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 11)
XX
DE   Mus musculus 16 days neonate cerebellum cDNA, RIKEN full-length enriched
DE   library, clone:9630041M10 product:UDP-Gal:betaGlcNAc beta
DE   1,4-galactosyltransferase, polypeptide 6, full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-4382
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (30-MAR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 4648a88d55f4478b75c8edaf725d918b.
DR   Ensembl-Gn; ENSMUSG00000056124; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000070080; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=9630041M10
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4382
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /dev_stage="16 days neonate"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="9630041M10"
FT                   /tissue_type="cerebellum"
FT                   /db_xref="taxon:10090"
FT   CDS             918..2066
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="UDP-Gal:betaGlcNAc beta 1,4-galactosyltransferase,
FT                   polypeptide 6 (MGD|MGI:1928380 GB|NM_019737, evidence:
FT                   BLASTN, 99%, match=4381)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q3UUA9"
FT                   /db_xref="InterPro:IPR003859"
FT                   /db_xref="InterPro:IPR027791"
FT                   /db_xref="InterPro:IPR027995"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="MGI:MGI:1928380"
FT                   /db_xref="UniProtKB/TrEMBL:Q3UUA9"
FT                   /protein_id="BAE23337.1"
FT                   /translation="MSALKRMMRVSNRSLIAFIFFFSLSTSCLYFIYVAPGIANTYLFM
FT                   VQARGIMLRENVKTIGHMIRLYTNKNTTLNGTDYPEGNNTSDYLVQTTTYLPQNFTYLP
FT                   HLPCPEKLPYMRGFLSVNVSEISFDEVHQLFSKDSEIGPGGHWRPKDCKPRWKVAVLIP
FT                   FRNRHEHLPIFFLHLIPMLQKQRLEFAFYVIEQTGTQPFNRAMLFNVGFKEAMKDRAWD
FT                   CVIFHDVDHLPENDRNYYGCGEMPRHFAAKLDKYMYILPYKEFFGGVSGLTVEQFRKIN
FT                   GFPNAFWGWGGEDDDLWNRVHYAGYNVTRPEGDLGKYISIPHHHRGEVQFLGRYKLLRY
FT                   SKERQYIDGLNNLLYTPKILVDRLYTNISVNLMPELAPIEDY"
FT   polyA_signal    4357..4362
FT                   /note="putative"
FT   polyA_site      4382
FT                   /note="putative"
XX
SQ   Sequence 4382 BP; 1051 A; 1105 C; 1023 G; 1203 T; 0 other;
     gcttggttcc tcttctccgg gcgcagcgcc gcctggcgag ttgtggaccg gcgggcggag        60
     ccttgcaggg gtctcggggc gcacagggct gtcgggattg tcctcgtggg tgtccgcggt       120
     ccgagatcgc ctcgcgtctg tcatcttttt ccttcgccct ccgggccccg gccgtgcgca       180
     tccgccgggt agtccggggt ctgtgcgggg gcggcgccgc ctctccctcg ggctccgcgg       240
     cgggaatgcg gctgctgtgg ccggctgggc agcgggcggc ggcagcaagc ggaacccggg       300
     cgcactcgcc gctggccggg acgccgccct ggcctgcgct ccgctcccga ggccgccgtt       360
     gcgctccggg gcccggcgcg gaatgaggtg caggccgcgc gacggcgagc gccccgctcc       420
     gcggccccca ggttccccgc gaccgtccgt gcctcgcgtg ccccggtgcc cactttagag       480
     cccccgcact agcagcgttc gccaaggcac aggcccgcag agcgcacgcg acccggaccg       540
     ggtcccgatc gcggggactc gcctcttgga cgccgccccg agtgcgggga ccccggcacg       600
     ctgcagcgcg cgggccgcac tccgcatcgc cgagctccgc cagcctggcc cgtggctttg       660
     gcctccaccg agcccggtct cccggcctcc cttcacgttt ctccgcatcc ttccaacacc       720
     cttcccgctg ctccaccgcc tcccattcat tgcatccgtt tctccttccc ggctcggttc       780
     ttctccccac agcctccccg gccggacccc gccaccttct tggggttctc cgtacattca       840
     tggaagttta gggcctggac cgtggcccgg agtctggcct gagagcgcag cccgcgctac       900
     tggcagggca gaggaagatg tctgcgctca agcggatgat gcgggtctcc aatcgctctc       960
     tgattgcctt catcttcttc ttctccctct ccacgtcctg tctctacttc atctatgtgg      1020
     ctccaggcat cgccaacacg tacctcttta tggtacaagc tagaggtatc atgctgagag      1080
     agaatgtgaa aacaattgga cacatgatca ggctgtatac caataaaaac actacgctca      1140
     acggaacaga ttatcctgaa ggcaataata caagtgacta tcttgttcaa acaacaacgt      1200
     atcttccgca aaacttcacg tatttgccac acctcccctg tccagagaag ctgccttaca      1260
     tgcggggatt cctcagtgtc aatgtgagtg agatcagttt tgatgaagtc catcagctct      1320
     tctccaagga ctcagagatt gggccaggag gccactggag gcccaaagac tgcaagccca      1380
     gatggaaggt ggcagttctc atccccttcc gtaaccgcca tgaacatctt ccgatttttt      1440
     tcctgcacct gattccgatg ctccagaaac agcggctgga atttgccttt tatgtcatcg      1500
     aacagaccgg cacacaacca ttcaatcgtg cgatgctctt taatgtgggt ttcaaagagg      1560
     ccatgaaaga cagagcctgg gactgtgtga tcttccatga tgtggatcat ctgcctgaaa      1620
     atgatcggaa ctactacgga tgtggagaga tgccgcggca ctttgcagcg aagctggaca      1680
     agtacatgta cattcttccc tataaggagt tttttggtgg ggtgagtggc ctgacggtgg      1740
     agcaattcag gaagatcaac ggctttccca atgccttctg gggatgggga ggcgaggacg      1800
     atgacctttg gaacagagtt cactacgccg gctacaatgt aacccggcca gaaggggact      1860
     tgggaaaata catatctatt cctcatcacc atcgagggga ggtacagttc ctaggacggt      1920
     ataaattact tcggtattcc aaggagcggc agtacatcga tggactgaac aatttattat      1980
     acacacccaa aatactggtt gataggctgt atacaaatat atctgtaaac ctcatgccag      2040
     aattagctcc aattgaagac tattaaaaga agtcattctc atggtggggt agaccacagt      2100
     gctggatcat gaacttggct tggagtgccc tcaccgtgga agttagagat tggggtgtat      2160
     ctcagtgtcc cggtctgtaa aaagagccag caatccttaa tgtttacagc gcgggctcca      2220
     tccgtcacac tctcccactc tccccctgct gggagcgtcc ccccatggca agcactgtag      2280
     agataagaac ccattgcttg ggactggaag tgaagaaaac tccctacaca gagaagattt      2340
     ttatactgaa atctataatt taattcaaga gaatgctttt atttccgttc aaacatattt      2400
     tgtacatatg tgatgtaaat taaatgtgtt caaattgttg gaaaacaaga tgtcacaatt      2460
     ttgcatgtaa ttggttatgc cttcattgga cttttataga cattttttta tttgcatggg      2520
     gaaaaatgta aatttatgtc gccaaacaaa ggttaagcct tgtgtcaaat gaagggactg      2580
     tcagcgacag acaaagataa tatagtaacc gttctgtact attggtgttc agctttagac      2640
     cttcagcctc atggcaggag gcacggtcct ctgagggctt cgaaggaagg aaggactcgc      2700
     ataacttttc ttcctgccac gattacctgt tttgttttgt ctattttttc ccttgcttgc      2760
     agtctcatca gatcttgcca agtcaacagc catattgttt atgcatactg catgagtatt      2820
     accaagaaaa ccttcccagt tgtaaagtga cgtgctgtac aggacttctt catgttaaat      2880
     gtctctatgt acctccgcgt gtcagggatc ttgtgcctca aaaaaacgtt cccaaggttg      2940
     tgtttataca cggttgtgtt tatacacggt atatatattt ttttcaatct cataatgaaa      3000
     acattattat tcccacctta gaagaaccaa aagagggtat cttcttttaa aaactttttt      3060
     tttttgaaag aatgacttta tggaaaatcc agtagtgctt atacagatga attatactat      3120
     tagatgagag attagatgct ctatttttat gaagatagat gcttagatta aaacaaactt      3180
     caactttaat tctcagacat acatggttcc ctttcacatt agctcgtcac tcctactgct      3240
     tttttcactt ttaagaaatc tctggtgtta tccaattttt ttttcactac aagtataatt      3300
     taatgcctac caccaccacc accaccccac caccaccacc atggtgctgg gcagtgagcc      3360
     gagggcctat agacttacct tacagtcatt aattgactgt gtggatattg tgacttctgc      3420
     tcaccctcca cacacgggtg aggttttcaa tgaccagaca acaacaaagc ccaaatagtg      3480
     ttcttacttt gaaaatgatt gattataaaa attcttgaaa aatagcctat attcacatgt      3540
     aagatcttat ctcccatctt taaacaaatt tagaacaaca tcgtctgtca agtaaaccct      3600
     aagagtgaga attctggatg tgagaaagtt tgctcccctt gtctaatgtt gagagcttag      3660
     ctttcagttg tcattgtctg tcatagtttt ggtaatgctg atgaccacaa gtcaaaccct      3720
     acagtgataa ctaaaattct tgcaccggag aagacagatg ccctgttgtg acagcaatct      3780
     ctccgtgttt attcttagaa ttgcttctaa aatatttacc tcccaacctt tttagctact      3840
     caaaaaagag tgaaaaaaaa atctcaactt ctggagatga agatttttgt atgttctcag      3900
     tttatgttct gtctcctgtg gctaatgaag tgtttaattt gaccgaatga cagcagaatg      3960
     taatgttaat gttaaggcgg gtgagacagg gctctttggc ccctccttac agtgctgtgg      4020
     gaagctgtgc catgtggaat tttattggag gacacacact tcataatgtg gcgggctgtc      4080
     cacagtgggg tgccttttgc attgatactt agttcacagt tttaggaaaa ttcagaactg      4140
     gtcatctgcc ttactttctt aggttaagtc tagtattaat atggcttccg gaattggatg      4200
     taagtaattt tgctatatct tcgtgttgca tctggaatgt cagcttgtga gaaccacctt      4260
     ttctaattca gacctggaat tcttttcagt aatgaatagt gacctgggta tgtttccatg      4320
     gatgacagtt ttgcctagtt accatgacca cgtgacaata aatctctttc ttacatatta      4380
     gc                                                                     4382
//


spacer
spacer