Dbfetch

ID   AK137203; SV 1; linear; mRNA; HTC; MUS; 2485 BP.
XX
AC   AK137203;
XX
DT   06-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 11)
XX
DE   Mus musculus adult male urinary bladder cDNA, RIKEN full-length enriched
DE   library, clone:9530042O20 product:arginine vasopressin receptor 1A, full
DE   insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2485
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (30-MAR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 87c9344443ba65437c2616e82e8c7087.
DR   Ensembl-Gn; ENSMUSG00000020123; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017789; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0017764; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0017727; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017728; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017552; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0018183; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0017112; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0017521; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0017627; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0017622; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0017701; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017650; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0018223; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0016897; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0017173; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000020323; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0027269; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0027239; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0027214; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0027217; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0027025; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0027721; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0026621; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0026949; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0027073; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0027070; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0027188; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0027048; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0027745; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0026326; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0026549; mus_musculus_wsbeij.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=9530042O20
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2485
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /sex="male"
FT                   /dev_stage="adult"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="9530042O20"
FT                   /tissue_type="urinary bladder"
FT                   /db_xref="taxon:10090"
FT   CDS             235..1506
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="arginine vasopressin receptor 1A (MGD|MGI:1859216
FT                   GB|NM_016847, evidence: BLASTN, 99%, match=2483)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q3U1H9"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR001224"
FT                   /db_xref="InterPro:IPR001817"
FT                   /db_xref="InterPro:IPR015076"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:1859216"
FT                   /db_xref="UniProtKB/TrEMBL:Q3U1H9"
FT                   /protein_id="BAE23266.1"
FT                   /translation="MSFPRGSHDLPAGNSSPWWPLTTEGANSSREAAGLGEGGSPPGDV
FT                   RNEELAKLEVTVLAVIFVVAVLGNSSVLLALHRTPRKTSRMHLFIRHLSLADLAVAFFQ
FT                   VLPQLCWDITYRFRGPDWLCRVVKHLQVFAMFASSYMLVVMTADRYIAVCHPLKTLQQP
FT                   ARRSRLMIAASWGLSFVLSIPQYFIFSVIEFEVNNGTKAQDCWATFIPPWGTRAYVTWM
FT                   TSGVFVVPVIILGTCYGFICYHIWRNVRGKTASRQSKGGKGSGEAAGPFHKGLLVTPCV
FT                   SSVKSISRAKIRTVKMTFVIVSAYILCWTPFFIVQMWSVWDTNFVWTDSENPSTTITAL
FT                   LASLNSCCNPWIYMFFSGHLLQDCVQSFPCCQSIAQKFAKDDSDSMSRRQTSYSNNRSP
FT                   TNSTGTWKDSPKSSKSIRFIPVST"
XX
SQ   Sequence 2485 BP; 597 A; 613 C; 658 G; 617 T; 0 other;
     gaagactgct ttgggagcag ggagagtccg ctcccttgcc tcggacaagc cggagcaggg        60
     acacgcaaga acatcccatc caaaaccact ctgagcgcgc gtgggattgc gcagcgaaga       120
     gagcgaggta aggaaggacg gtgcgcagaa cttaggacgc gggtcttcgg gtcctccgtg       180
     gagaagagga agcagcccac gaggaacagg gttccccggc tctgtgccga cagcatgagt       240
     ttcccgcgag gctcccacga tctgcccgcg ggcaactcca gcccgtggtg gcctctgacc       300
     accgagggcg ccaacagcag ccgggaagca gctgggctcg gggaaggcgg cagcccgccg       360
     ggggacgtac gcaacgagga gctggcgaag ctggaggtta ccgtgctggc ggtgattttc       420
     gtggtggccg tgctgggtaa tagcagtgtg ctgctggcgc tgcatcgcac gccacgcaag       480
     acatcccgca tgcatctctt catccgacac ctcagcctgg cagacctggc ggtcgccttc       540
     ttccaagtgt taccacagct gtgctgggac atcacctacc gcttccgcgg gccggactgg       600
     ctgtgccggg tggtgaagca cttgcaggtg tttgccatgt tcgcatcttc ctacatgctg       660
     gtggtgatga cggctgaccg ctacatcgcc gtgtgccacc cgctcaagac cctgcagcag       720
     cccgcgcgcc gctcgcgcct catgatcgcc gcctcttggg ggctgagttt cgttctgagc       780
     ataccacagt actttatctt ctctgtgatc gaatttgagg tgaacaatgg caccaaagcc       840
     caagattgct gggctacctt catcccgccc tggggtaccc gtgcctacgt gacctggatg       900
     accagcgggg tcttcgtggt acccgtgatc atcttgggta cctgctatgg cttcatctgt       960
     taccacatct ggcgcaatgt ccgagggaag acagcatcgc gacagagcaa aggcggcaag      1020
     ggctctgggg aagccgcggg tcccttccac aaggggcttc tggtcacgcc ttgtgtcagc      1080
     agcgtgaaga gcatttcccg tgccaagatc cgcacagtga agatgacctt tgtgattgta      1140
     agcgcctaca tcctctgctg gacacctttc ttcatcgtcc agatgtggtc agtctgggat      1200
     accaatttcg tttggaccga ttccgaaaac ccttccacca cgatcacggc gttactggct      1260
     tccttgaaca gctgctgcaa cccgtggatc tacatgtttt ttagtggtca tctcctacaa      1320
     gattgtgtcc agagcttccc atgctgccaa agcatagcgc agaaattcgc caaggatgac      1380
     tcggatagca tgagccggag acagacatct tattctaaca accgaagccc aacaaacagc      1440
     actgggacgt ggaaggattc acctaaatct tcaaagtcca tcagatttat ccctgtctcc      1500
     acttgagccg catatccacg cagccagact cttggacggg gcttgtgtgt ccagctagag      1560
     agcttaagag taaatatgtt tatgtgacat agacataaat caactcagtg tatacattgt      1620
     ttctacaact tggtgtatac attgtttcta caattcagtg tatacattgt ttctagctgt      1680
     gtttttccca ttgctgtgac caaaacctga attcttttgc atagcatatt aatgaaaatg      1740
     taccacatgg gaaatgtata ggcctggttc gtaagcatac tgactttata ttttgtggtt      1800
     gatttttttt tattgtattt ttatgtctaa tgtgaggctt ggattggttt aagtcatgtg      1860
     ataagcactg ttgtttctac acaaagtgaa ctggtccgtg attgaaaacc cagtgttgct      1920
     gtcaatctgt gtgtcataaa atgtcagcaa gaggtagaga ggagttgggt tgagggtggg      1980
     aaggaggtag cttggtacct ggctgccctt ccttcagagt cctgacactc tattagcact      2040
     gaaaatcatg ctcaccaaca gacagaaggt ttgagaatgt tttaggacaa taatttgtat      2100
     gggggggggg tgccacactt tatagaggca taagagaaaa gatttctaca gacattcttt      2160
     gggatatttt aaacatccat ggaccagcac caaggtagtc tgtgctacac cagatgttaa      2220
     cacttagtac ctagtcggtg aatccagatt cagagattct aagtctccta gataactcaa      2280
     gacataagat actcaaaaca tgttgattta aatcagttta tttatttctt cacatttccc      2340
     atccacacag cagggccaga acacagaggg tgaagacatg tggagaaacg ggagacagac      2400
     agaaagagag gggggtctga gccttgtgtc tgttccttca tgaatgtatg attttcagaa      2460
     agatacttaa aaatatttaa agccg                                            2485
//