spacer

EBI Dbfetch

ID   AK136496; SV 1; linear; mRNA; HTC; MUS; 3959 BP.
XX
AC   AK136496;
XX
DT   06-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 11)
XX
DE   Mus musculus adult male cecum cDNA, RIKEN full-length enriched library,
DE   clone:9130002N05 product:guanylate cyclase 2c, full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-3959
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (30-MAR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; ada6141bf1505932813f71e9192e0074.
DR   Ensembl-Gn; ENSMUSG00000042638; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000032338; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000078095; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=9130002N05
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3959
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /sex="male"
FT                   /dev_stage="adult"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="9130002N05"
FT                   /tissue_type="cecum"
FT                   /db_xref="taxon:10090"
FT   CDS             161..3379
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="guanylate cyclase 2c (MGD|MGI:106903 GB|BC034064,
FT                   evidence: BLASTN, 98%, match=2844)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q3UWA6"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR001245"
FT                   /db_xref="InterPro:IPR001828"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR018297"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="MGI:MGI:106903"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3UWA6"
FT                   /protein_id="BAE23010.1"
FT                   /translation="MTSLLGLAVRLLLFQPALMVFWASQVRQNCRNGSYEISVLMMDNS
FT                   AYKEPMQNLREAVEEGLDIVRKRLREADLNVTVNATFIYSDGLIHKSGDCRSSTCEGLD
FT                   LLREITRDHKMGCALMGPSCTYSTFQMYLDTELNYPMISAGSYGLSCDYKETLTRILPP
FT                   ARKLMYFLVDFWKVNNASFKPFSWNSSYVYKNGSEPEDCFWYLNALEAGVSYFSEVLNF
FT                   KDVLRRSEQFQEILTGHNRKSNVIVMCGTPESFYDVKGDLQVAEDTVVILVDLFSNHYF
FT                   EENTTAPEYMDNVLVLTLPSEQSTSNTSVAERFSSGRSDFSLAYLEGTLLFGHMLQTFL
FT                   ENGENVTGPKFARAFRNLTFQGFAGPVTLDDSGDIDNIMSLLYVSLDTRKYKVLMKYDT
FT                   HKNKTIPVAENPNFIWKNHKLPNDVPGLGPQILMIAVFTLTGILVVLLLIALLVLRKYR
FT                   RDHALRQKKWSHIPSENIFPLETNETNHISLKIDDDRRRDTIQRVRQCKYDKKKVILKD
FT                   LKHSDGNFSEKQKIDLNKLLQSDYYNLTKFYGTVKLDTRIFGVVEYCERGSLREVLNDT
FT                   ISYPDGTFMDWEFKISVLNDIAKGMSYLHSSKIEVHGRLKSTNCVVDSRMVVKITDFGC
FT                   NSILPPKKDLWTAPEHLRQATISQKGDVYSFAIIAQEIILRKETFYTLSCRDHNEKIFR
FT                   VENSYGKPFRPDLFLETADEKELEVYLLVKSCWEEDPEKRPDFKKIESTLAKIFGLFHD
FT                   QKNESYMDTLIRRLQLYSRNLEHLVEERTQLYKAERDRADHLNFMLLPRLVVKSLKEKG
FT                   IVEPELYEEVTIYFSDIVGFTTICKYSTPMEVVDMLNDIYKSFDQIVDHHDVYKVETIG
FT                   DAYVVASGLPMRNGNRHAVDISKMALDILSFIGTFELEHLPGLPVWIRIGVHSGPCAAG
FT                   VVGIKMPRYCLFGDTVNTASRMESTGLPLRIHMSSSTITILKRTDCQFLYEVRGETYLK
FT                   GRGTETTYWLTGMKDQEYNLPSPPTVENQQRLQTEFSDMIVSALQKRQASGKKSRRPTR
FT                   VASYKKGFLEYMQLNNSDHDSTYF"
FT   polyA_signal    3940..3945
FT                   /note="putative"
FT   polyA_site      3959
FT                   /note="putative"
XX
SQ   Sequence 3959 BP; 1036 A; 951 C; 1029 G; 943 T; 0 other;
     gaggctgagt ctcacggccc gtgtgaccag tgtggcaaga ccagaaaggt gcgtggggaa        60
     gagaagacca agggactctg ctagcgactc tccagagggg ctccctgtgt ctctaaaagc       120
     gagcaatcca ggggggcatg gtgctacggt gagccaggtc atgacgtcac tgctgggctt       180
     ggctgtgcgg ttactgctct tccagcccgc gctgatggtg ttctgggcct ctcaggtgag       240
     gcagaactgc cgcaatggca gctacgagat cagcgtcctg atgatggaca actcagccta       300
     caaagaacct atgcaaaacc tgagggaggc tgtggaggaa ggactggaca tagtgcgaaa       360
     gcgcctgcgt gaagccgacc taaatgtgac tgtgaacgcg actttcatct actccgacgg       420
     tctgattcat aagtcaggtg actgccggag cagcacctgt gaaggccttg acctactcag       480
     ggagattaca agagatcata agatgggctg cgccctcatg gggccctcgt gcacgtattc       540
     caccttccag atgtacctcg acacagagtt gaactatccc atgatttccg ctggaagtta       600
     tggattgtcc tgtgactata aggaaaccct aaccaggatc ctgcctccag ccaggaagct       660
     gatgtacttc ttggtcgatt tctggaaagt caacaatgca tctttcaaac ccttttcctg       720
     gaactcttcg tatgtttaca agaatggatc ggaacctgaa gattgtttct ggtacctcaa       780
     tgctctggag gctggggtgt cctatttttc tgaggtgctc aacttcaagg atgtactgag       840
     acgcagcgaa cagttccagg aaatcttaac aggccataac agaaagagca atgtgattgt       900
     tatgtgtggc acgccagaaa gcttctatga tgtgaaaggt gacctccaag tggctgaaga       960
     tactgttgtc atcctggtag atctgttcag taaccattac tttgaggaga acaccacagc      1020
     tcctgagtat atggacaatg tcctcgtcct gacgctgccg tctgaacagt ccacctcaaa      1080
     cacctctgtc gccgagaggt tttcatcggg gagaagtgac ttttctctcg cttacttgga      1140
     gggaaccttg ctatttggac acatgctgca gacgtttctt gaaaatggag aaaatgtcac      1200
     gggtcccaag tttgctcgtg cattcaggaa tctcactttt caaggctttg caggacctgt      1260
     gactctggat gacagtgggg acattgacaa cattatgtcc cttctgtatg tgtctctgga      1320
     taccaggaaa tacaaggttc ttatgaagta tgacacccac aaaaacaaaa ctattccggt      1380
     ggctgagaac cccaacttca tctggaagaa ccacaagctc cccaatgacg ttcctgggct      1440
     gggccctcaa atcctgatga ttgccgtctt cacgctcacg gggatcctgg tagttctgct      1500
     gctgattgcc ctcctcgtgc tgagaaaata cagaagagat catgcacttc gacagaagaa      1560
     atggtcccac attccttctg aaaacatctt tcctctggag accaacgaga ccaaccacat      1620
     cagcctgaag attgacgatg acaggagacg agacacaatc cagagagtgc gacagtgcaa      1680
     atacgacaag aagaaagtga ttctgaaaga cctcaagcac agcgacggga acttcagtga      1740
     gaagcagaag atagacctga acaagttgct gcagtctgac tactacaacc tgactaagtt      1800
     ctacggcacc gtgaagctgg acaccaggat ctttggggtg gttgagtact gcgagagggg      1860
     atccctccgg gaagtgttaa acgacacaat ttcctaccct gacggcacgt tcatggattg      1920
     ggagtttaag atctctgtct taaatgacat cgctaagggg atgtcctacc tgcactccag      1980
     taagattgaa gtccacgggc gtctcaaatc caccaactgc gtggtggaca gccgcatggt      2040
     ggtgaagatc accgactttg ggtgcaattc catcctgcct ccaaaaaaag acctgtggac      2100
     ggccccggag cacctgcgcc aggccaccat ctctcagaaa ggagacgtgt acagcttcgc      2160
     catcattgcc caggagatca tcctccgtaa ggagactttt tacacgctga gctgtcggga      2220
     tcacaatgag aagattttca gagtggaaaa ttcatacggg aaacctttcc gcccagacct      2280
     cttcctggag actgcagatg agaaggagct ggaggtctat ctacttgtca aaagctgttg      2340
     ggaggaggat ccagaaaaga ggccagattt caagaaaatc gagagcacac tggccaagat      2400
     atttggcctt ttccatgacc agaaaaacga gtcttacatg gacaccttga tccgacgtct      2460
     ccagctgtac tctcgaaacc tggaacatct ggtggaggaa aggactcagc tgtacaaggc      2520
     ggagagggac agggctgacc accttaactt catgctcctc ccacggctgg tggtaaagtc      2580
     actgaaggag aaaggcatcg tggagccaga gctgtacgaa gaagtcacaa tctacttcag      2640
     tgacattgtg ggcttcacca ccatctgcaa gtatagcacg cccatggagg tggtggacat      2700
     gctcaacgac atctacaaga gctttgacca gattgtggac caccatgacg tctacaaggt      2760
     agaaaccatc ggtgacgcct acgtggtggc cagcggtctg cctatgagaa acggcaaccg      2820
     acacgcggta gacatttcca agatggcctt ggacatcctc agcttcatag ggacctttga      2880
     gttggagcat ctccctggcc tccccgtgtg gatccgcatt ggagttcatt ctgggccctg      2940
     cgctgctggt gttgtgggga tcaagatgcc tcgctattgc ctgtttggag acactgtcaa      3000
     cactgcctcc aggatggaat ccaccggcct ccccttgagg attcacatga gcagctccac      3060
     cataaccatc ctgaagagaa cggattgcca gttcctgtat gaagtgaggg gagaaaccta      3120
     cttaaaggga agagggacag agaccacata ctggctgact gggatgaagg accaagaata      3180
     caacctgcca tccccaccga cagtggagaa ccaacagcgt ctgcagactg agttctcaga      3240
     catgatcgtt agcgccttac agaaaagaca ggcctcgggc aagaagagcc ggaggcccac      3300
     tcgggtggcc agctacaaga aaggctttct ggaatacatg cagctgaaca attcagacca      3360
     cgatagcacc tatttttaga ccaagtgagg tctgagaact gacagtagca acctcctata      3420
     tcatgaatct gtattttcca gagacctcaa caacatagac aagcacttag cctcagtgcc      3480
     ctgactggaa cgtagaacca acccctcaag tcatgtgggt ctgattttgg gttggttggt      3540
     tggttggttg gttggttttg gttttgttga gacagagttt cgtgtatccc aagctggtct      3600
     caaactcact gtgtagcagc agatgacttt ggacttctaa gatcatccgt gtgtgttcct      3660
     gacagtgtga tgagtgtata cgtcagagcc ctgtcccaca gttctccatg gagcatcaac      3720
     ctgaatggag gagcgaggag ggggaatgtc ctgtgctgta cagaacttgg ggttttgttc      3780
     taattttatc tctggtttgg ttttgttttc tggctccttc cctctctatg tgtgagagaa      3840
     gtttttaaat tgtctgaatt gtatgctaag tagcttatct acaagaaagt gtgtttaact      3900
     agtgattttt gcagaaacca tgctggatat taggtaaaaa ataaaagtgt ttagagtcg       3959
//


spacer
spacer