spacer

EBI Dbfetch

ID   AK136273; SV 1; linear; mRNA; HTC; MUS; 2390 BP.
XX
AC   AK136273;
XX
DT   06-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 11)
XX
DE   Mus musculus adult male eyeball cDNA, RIKEN full-length enriched library,
DE   clone:7530406E11 product:calcium channel, voltage-dependent, alpha 1F
DE   subunit, full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2390
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (30-MAR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 0c32dddb2116999caa0df7faf1a5c5fd.
DR   Ensembl-Gn; ENSMUSG00000031142; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000115725; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=7530406E11
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2390
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /sex="male"
FT                   /dev_stage="adult"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="7530406E11"
FT                   /tissue_type="eyeball"
FT                   /db_xref="taxon:10090"
FT   CDS             <1..2318
FT                   /codon_start=3
FT                   /transl_table=1
FT                   /note="calcium channel, voltage-dependent, alpha 1F subunit
FT                   (MGD|MGI:1859639 GB|BC051413, evidence: BLASTN, 99%,
FT                   match=2390)"
FT                   /note="putative"
FT                   /note="start codon is not identified"
FT                   /db_xref="GOA:Q3UWK7"
FT                   /db_xref="InterPro:IPR002077"
FT                   /db_xref="InterPro:IPR005821"
FT                   /db_xref="InterPro:IPR014873"
FT                   /db_xref="InterPro:IPR027359"
FT                   /db_xref="MGI:MGI:1859639"
FT                   /db_xref="UniProtKB/TrEMBL:Q3UWK7"
FT                   /protein_id="BAE22907.1"
FT                   /translation="TVALAMQHYEQTAPFNYAMDILNMVFTGLFTIEMVLKIIAFKPKH
FT                   YFADAWNTFDALIVVGSVVDIAVTEVNSSEDSSRISITFFRLFRVMRLVKLLSKGEGIR
FT                   TLLWTFIKSFQALPYVALLIAMIFFIYAVIGMQMFGKVALQDGTQINRNNNFQTFPQAV
FT                   LLLFRCATGEAWQEIMLASLPGNRCDPESDFGPGEEFTCGSSFAIVYFISFFMLCAFLI
FT                   INLFVAVIMDNFDYLTRDWSILGPHHLDEFKRIWSEYDPGAKGRIKHLDVVALLRRIQP
FT                   PLGFGKLCPHRVACKRLVAMNVPLNSDGTVTFNATLFALVRTSLKIKTEGNLDQANQEL
FT                   RMVIKKIWKRIKQKLLDEVIPPPDEEEVTVGKFYATFLIQDYFRKFRRRKEKGLLGREA
FT                   PTSTSSALQAGLRSLQDLGPEIRQALTYDTEEEEEEEEAVGQEAEEEEAENNPEPYKDS
FT                   IDSQPQSRWNSRISVSLPVKEKLPDSLSTGPSDDDGLAPNSRQPSVIQAGSQPHRRSSG
FT                   VFMFTIPEEGSIQLKGTQGQDNQNEEQEVPDWTPDLDEQAGTPSNPVLLPPHWSQQHVN
FT                   GHHVPRRRLLPPTPAGRKPSFTIQCLQRQGSCEDLPIPGTYHRGRTSGPSRAQGSWAAP
FT                   PQKGRLLYAPLLLVEESTVGEGYLGKLGGPLRTFTCLQVPGAHPNPSHRKRGSADSLVE
FT                   AVLISEGLGLFAQDPRFVALAKQEIADACHLTLDEMDSAASDLLAQRTTSLYSDEESIL
FT                   SRFDEEDLGDEMACVHAL"
XX
SQ   Sequence 2390 BP; 582 A; 654 C; 610 G; 544 T; 0 other;
     acacggtggc cctagccatg cagcactatg aacagactgc tccctttaac tatgccatgg        60
     acatcctcaa catggtcttc actggcctct tcaccattga gatggtgctc aaaatcatcg       120
     cctttaaacc caagcattac tttgcagatg cctggaatac gtttgatgct ctcattgtag       180
     tgggcagtgt agtcgacatc gccgtcacag aagtcaatag ttcagaggac agctcccgca       240
     tatctatcac gttctttcgc ctcttccgag tcatgaggct ggtcaagctt ctgagtaagg       300
     gtgaggggat ccgcacactg ctctggacat tcatcaagtc tttccaggcc ttgccctatg       360
     tggcacttct catagcaatg atattcttca tctatgcagt cattggcatg cagatgtttg       420
     gcaaggtggc tcttcaggac ggcacgcaga taaatcgaaa caacaatttc cagacctttc       480
     cgcaggctgt gctgcttctg ttcaggtgtg ccactggtga ggcctggcaa gagataatgc       540
     tagccagcct tccaggaaat cgatgtgacc ctgagtctga ctttggccca ggcgaggaat       600
     ttacctgtgg tagcagtttt gccatcgtct acttcatcag cttctttatg ctctgtgcct       660
     tcctgattat aaatctcttt gtggctgtaa tcatggataa ctttgattac ctaaccagag       720
     attggtctat cctgggaccc caccaccttg atgaattcaa gaggatctgg tctgaatatg       780
     accccggagc caagggccgc atcaagcact tggatgtggt tgccctgctg agacgcatcc       840
     agcccccatt gggatttgga aagctatgcc cacaccgagt ggcctgcaag agactcgtgg       900
     caatgaatgt gcccctcaac tcagatggaa cagtgacatt caacgctaca ctctttgccc       960
     tggtgcggac atccctgaag atcaagacag aagggaacct ggatcaagcc aaccaggagc      1020
     ttcggatggt catcaaaaag atctggaagc ggataaagca gaaattgttg gatgaggtca      1080
     tccctcctcc cgatgaggag gaggtcactg tgggaaaatt ctatgccaca ttcctgatcc      1140
     aagattattt ccgaaaattc cggagaagga aagaaaaggg gctactagga agagaggccc      1200
     caacaagcac atcctctgcc ctccaggctg gtctaaggag cctgcaggac ttgggtcctg      1260
     agatccgtca agccctcacc tatgacactg aggaagaaga ggaagaggaa gaggcagtgg      1320
     gtcaggaggc tgaggaagag gaagctgaga acaacccaga accatacaaa gactccatag      1380
     actcccagcc ccaatctcga tggaactcta ggatttcggt gtctctacct gttaaggaga      1440
     aacttccaga ttctctctca actgggccga gtgatgatga tgggctggct cccaactcca      1500
     ggcagcccag tgtgatacag gctggctccc aaccacacag gagaagctct ggggttttca      1560
     tgttcactat cccggaagaa ggaagtattc agctcaaggg aactcaaggg caggacaatc      1620
     agaatgagga acaggaagtc cctgactgga ctcctgacct ggatgagcag gccgggactc      1680
     cttcgaaccc agtcctttta ccacctcact ggtcccagca acacgtaaac gggcaccatg      1740
     tgccacgccg acgtttgctg ccccccacgc ctgcaggtcg gaagccctcc ttcaccatcc      1800
     agtgtctgca acgccagggc agttgtgaag atttacctat cccaggcacc taccatcgtg      1860
     gacggacctc aggaccaagc agggctcagg gttcctgggc agcccctcct cagaagggtc      1920
     gactgctata tgcccccctg ttgttggtgg aggaatctac agtgggtgaa ggataccttg      1980
     gcaaacttgg cggcccactg cgtaccttca cctgtctgca agtgcctgga gctcatccga      2040
     atcccagcca ccgcaagagg ggcagtgctg acagtttggt ggaggctgtg ctcatctccg      2100
     aaggcctagg tctctttgcc caagacccac gatttgtggc cctggccaag caggagattg      2160
     cagatgcatg tcacctgacc ctggatgaga tggacagtgc tgccagtgac ctgctggcac      2220
     agagaaccac ctccctttac agtgatgagg agtctattct ttcccgcttt gatgaagagg      2280
     acctgggaga tgagatggcc tgtgtccatg ccctctaaat ccttacccct catctactgc      2340
     tcaataaact ccctgccctt ccttccccca gagggaggca ggcatggacc                 2390
//


spacer
spacer