Dbfetch

ID   AK135770; SV 1; linear; mRNA; HTC; MUS; 2487 BP.
XX
AC   AK135770;
XX
DT   06-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 11)
XX
DE   Mus musculus in vitro fertilized eggs cDNA, RIKEN full-length enriched
DE   library, clone:7420414C05 product:bone morphogenetic protein 6, full insert
DE   sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2487
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (30-MAR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 3e18b2360e05b2e02661a6242f9b28f9.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=7420414C05
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2487
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="7420414C05"
FT                   /tissue_type="in vitro fertilized eggs"
FT                   /db_xref="taxon:10090"
FT   CDS             <1..1383
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="bone morphogenetic protein 6 (MGD|MGI:88182
FT                   GB|NM_007556, evidence: BLASTN, 99%, match=2044)"
FT                   /note="putative"
FT                   /note="start codon is not identified"
FT                   /db_xref="GOA:Q3UXB2"
FT                   /db_xref="InterPro:IPR001111"
FT                   /db_xref="InterPro:IPR001839"
FT                   /db_xref="InterPro:IPR015615"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017948"
FT                   /db_xref="InterPro:IPR029034"
FT                   /db_xref="MGI:MGI:88182"
FT                   /db_xref="UniProtKB/TrEMBL:Q3UXB2"
FT                   /protein_id="BAE22651.1"
FT                   /translation="AEQPPPQSSSSGFLYRRLKTHEKREMQKEILSVLGLPHRPRPLHG
FT                   LQQPQPPVLPPQQQQQQQQQQTAREEPPPGRLKSAPLFMLDLYNALSNDDEEDGASEGV
FT                   GQEPGSHGGASSSQLRQPSPGAAHSLNRKSLLAPGPGGGASPLTSAQDSAFLNDADMVM
FT                   SFVNLVEYDKEFSPHQRHHKEFKFNLSQIPEGEAVTAAEFRVYKDCVVGSFKNQTFLIS
FT                   IYQVLQEHQHRDSDLFLLDTRVVWASEEGWLEFDITATSNLWVVTPQHNMGLQLSVVTR
FT                   DGLHVNPRAAGLVGRDGPYDKQPFMVAFFKVSEVHVRTTRSASSRRRQQSRNRSTQSQD
FT                   VSRGSGSSDYNGSELKTACKKHELYVSFQDLGWQDWIIAPKGYAANYCDGECSFPLNAH
FT                   MNATNHAIVQTLVHLMNPEYVPKPCCAPTKLNAISVLYFDDNSNVILKKYRNMVVRACG
FT                   CH"
FT   regulatory      2465..2470
FT                   /note="putative"
FT                   /regulatory_class="polyA_signal_sequence"
FT   polyA_site      2487
FT                   /note="putative"
XX
SQ   Sequence 2487 BP; 586 A; 695 C; 658 G; 548 T; 0 other;
     gctgagcagc caccgccaca gtcctcttct tcgggcttcc tctatcggcg gctcaagacc        60
     cacgagaagc gggagatgca aaaggagatc ctgtcggtgc tggggctccc gcacaggccg       120
     cggcccctgc acggtctcca gcagcctcag cccccggtgc tcccgccaca gcagcagcag       180
     cagcagcagc agcagcagac ggcccgcgag gagccccctc cagggcggct gaagtccgct       240
     ccactcttca tgctggatct ctacaacgcc ctgtccaatg acgacgaaga ggatggggca       300
     tcggagggtg tggggcaaga gcctgggtcc cacggagggg ccagctcgtc ccagctcagg       360
     cagccgtctc ccggcgctgc acactccttg aaccgcaaga gtctcctggc cccgggaccc       420
     ggtggcggtg cgtccccact gactagcgcg caggacagcg ctttcctcaa cgacgcggac       480
     atggtcatga gctttgtgaa cctggtggag tacgacaagg agttctcccc acatcaacga       540
     caccacaaag agttcaagtt caacctatcc cagattcctg agggtgaggc ggtgacggct       600
     gctgagttcc gcgtctacaa ggactgtgtg gtggggagtt ttaaaaacca aacctttctt       660
     atcagcattt accaagtctt gcaggagcat cagcacagag actctgacct atttttgttg       720
     gacacccggg tggtgtgggc ctcagaagaa ggttggctgg aatttgacat cacagcaact       780
     agcaatctgt gggtggtgac accgcagcac aacatggggc tccagctgag tgtggtgact       840
     cgggatggac tccacgtcaa cccccgtgcg gcgggcctgg tgggcagaga cggcccttac       900
     gacaagcagc ccttcatggt ggccttcttc aaggtgagcg aggtccacgt gcgcaccacc       960
     aggtcagcct ccagtcggcg gcggcagcag agtcgcaacc ggtccaccca gtcgcaggac      1020
     gtgtcccggg gctccggttc ttcagactac aacggcagtg agttaaaaac agcttgcaag      1080
     aagcatgagc tctatgtgag cttccaggac ctgggatggc aggactggat cattgcaccc      1140
     aaaggctacg ctgccaacta ctgtgatgga gagtgttcct tcccactcaa cgcacacatg      1200
     aatgccacca accacgccat tgtacagacc ttggtccacc ttatgaatcc cgagtacgtc      1260
     cccaaaccat gctgcgcacc aaccaaactg aatgccatct cggttcttta cttcgatgat      1320
     aactccaatg tcatcttgaa aaagtacagg aatatggtcg tgagagcttg tggttgccat      1380
     taagttgaag ctggtgtgtg tgtgtgggtg ggggcatggt tctgccttgg attcctaaca      1440
     acaacatctg ccttaaacca cgaacaacag cacagcgaag cgggatggtg acacacagag      1500
     ggatcgtgac acgcagacac atctcccgct ggtgccttac ccacggaggc ttttatgagg      1560
     accttgtcaa gggctttccc agttcctaag ctgagcagtt gctggtctgc aggaagctgg      1620
     aaggcttgta gtacaggcct ggaaactgca gttacctaat gttcgcctcc cccaaccccg      1680
     cccggagtag ttttagcttt tagatctagc tgcttgtggt gtaagtagag agtaaacttg      1740
     aaggaatatt aaatatccct gggttgaaag acccggtggt ggctctacag cacccatccc      1800
     agggagattt ttgcagacat ccgaatggag gggagaaggg cactctttca ggttccattc      1860
     ccagcaaggg cagctcacac aggacctgca gcctggccat cagcaggctc tgtggaggtg      1920
     ccttctgtct actgttgtag ttacgtgttt tgtgttgact ctcggtggtg tgagaatgta      1980
     ctaatctctg tcaagacaaa ctgtagcatt tccaccccat cctcctccct ccctcacaga      2040
     attctttact agaacccaaa gtagacagac cgtactttgt ggcagagcca tgaagcatct      2100
     gccgtagccg tcatttaagc cacagaacag cagaatttga ttctacatct cgtgggcagc      2160
     ctggctggac atgcgtgtta acatcaggaa cactggctcc aacatcggct ctgtaacccc      2220
     taactctgct ctttgccttt tccctaccta agcattccat ggctcagggc tagagtctaa      2280
     agccgaaacc cagagaggga agggccctgc ctgtaagaat gggtttgtca aggtgagcat      2340
     gctgtgtgta aaccaaaacc accatttcct cctgtagaaa gtaagactca gactgaatct      2400
     tagaatattt tttaaatgtc cttttcacaa tcatgtaccg ggaagccaat ttcatactaa      2460
     actgattaaa taatacattt acaatct                                          2487
//