spacer

EBI Dbfetch

ID   AK135517; SV 1; linear; mRNA; HTC; MUS; 1281 BP.
XX
AC   AK135517;
XX
DT   06-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 11)
XX
DE   Mus musculus 12 days embryo female mullerian duct includes surrounding
DE   region cDNA, RIKEN full-length enriched library, clone:6820441K12
DE   product:nucleophosmin 1, full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1281
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (30-MAR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 0eea5f6de8f123db72c8e902d0ff1dfb.
DR   Ensembl-Gn; ENSMUSG00000057113; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000075641; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=6820441K12
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1281
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /sex="female"
FT                   /dev_stage="12 days embryo"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="6820441K12"
FT                   /tissue_type="mullerian duct includes surrounding region"
FT                   /db_xref="taxon:10090"
FT   CDS             99..977
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="nucleophosmin 1 (MGD|MGI:106184 GB|AK028253,
FT                   evidence: BLASTN, 100%, match=1280)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q5SQB7"
FT                   /db_xref="InterPro:IPR004301"
FT                   /db_xref="InterPro:IPR024057"
FT                   /db_xref="MGI:MGI:106184"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SQB7"
FT                   /protein_id="BAE22562.1"
FT                   /translation="MEDSMDMDMSPLRPQNYLFGCELKADKDYHFKVDNDENEHQLSLR
FT                   TVSLGAGAKDELHIVEAEAMNYEGSPIKVTLATLKMSVQPTVSLGGFEITPPVVLRLKC
FT                   GSGPVHISGQHLVAVEEDAESEDEDEEDVKLLGMSGKRSAPGGGNKVPQKKVKLDEDDE
FT                   DDDEDDEDDEDDDDDDFDEEETEEKVPVKKSVRDTPAKNAQKSNQNGKDLKPSTPRSKG
FT                   QESFKKQEKTPKTPKGPSSVEDIKAKMQASIEKGGSLPKVEAKFINYVKNCFRMTDQEA
FT                   IQDLWQWRKSL"
FT   polyA_signal    1256..1261
FT                   /note="putative"
FT   polyA_site      1281
FT                   /note="putative"
XX
SQ   Sequence 1281 BP; 420 A; 221 C; 312 G; 328 T; 0 other;
     gccttggcgt gattccgtcc tgcgcgtctg ttctgtggaa caggaggcag ttgttttccg        60
     tccggcttct cccacaccga agtgcgcgcc tccacctcat ggaagactcg atggatatgg       120
     acatgagtcc tcttaggcct cagaactacc ttttcggctg tgaactaaag gctgacaaag       180
     actatcactt taaagtggat aatgatgaaa atgagcacca gttgtcatta agaacggtca       240
     gtttaggagc aggggcaaaa gatgagttac acatcgtaga ggcagaagca atgaactatg       300
     aaggcagtcc aattaaagta acactggcaa ctttgaaaat gtctgtacaa ccaacagttt       360
     ccctaggggg ctttgaaatt acaccacctg tggtcttacg gttgaagtgt ggttcagggc       420
     ctgtgcacat tagtggacag catctagtag ctgtagagga agatgcagag tctgaagatg       480
     aagatgagga ggacgtaaaa ctcttaggca tgtctggaaa gcgatctgct cctggaggtg       540
     gtaacaaggt tccacagaaa aaagtaaaac ttgatgaaga tgatgaggac gatgatgagg       600
     acgatgagga tgatgaggat gatgatgatg atgattttga tgaagaggaa actgaagaaa       660
     aggtcccagt gaagaaatct gtacgagata ccccagccaa aaatgcacaa aaatcaaacc       720
     aaaatggaaa agacttaaaa ccatcaacac cgagatcaaa gggtcaagag tccttcaaaa       780
     aacaggaaaa gactcctaaa acaccaaaag gacctagttc tgtagaagac attaaggcaa       840
     aaatgcaagc aagtatagaa aaaggcggtt ctcttcccaa agtggaagcc aagttcatta       900
     attatgtgaa gaattgtttc cggatgactg accaggaggc tattcaagat ctctggcagt       960
     ggaggaaatc tctttaagaa aagggtttaa acagtttgaa atattctgtc ttcatttctg      1020
     taatagttaa tatctggctg tcctttttat aatgcaaagt gagaactttc cctactgtgt      1080
     ttgataaatg ttgtccaggt tcacttgcca agaatgtgtt gtctaaaatg cctgtttagt      1140
     tttcaaggat ggaactccac cctttacttg gttttaagta tgtatggaat gttatgatag      1200
     gacatagtaa tagtggtcag atgtggaaat ggtagggaga caaatataca tgtgaaataa      1260
     actcagtatt ttaataaagt g                                                1281
//


spacer
spacer